KEGG   Pantoea ananatis AJ13355: PAJ_0068Help
Entry
PAJ_0068          CDS       T01969                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B DdlB
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00473  D-Alanine metabolism
paj00550  Peptidoglycan biosynthesis
paj01100  Metabolic pathways
paj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PAJ_0068 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PAJ_0068 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PAJ_0068 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paj01011]
    PAJ_0068 (ddlB)
Enzymes [BR:paj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PAJ_0068 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:paj01011]
 Precursor biosynthesis
  Amino acid ligase
   PAJ_0068 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 TTL ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: BAK10148
UniProt: A0A0H3KWW2
LinkDB All DBs
Position
84543..85460
Genome map
AA seq 305 aa AA seqDB search
MTKVAVLMGGTSAERDVSLMSGGAVLAGLREAGIDAQGIDTRDVSVLELTAQGFEKVFIA
LHGRGGEDGTLQAVLEFLQLPYTGSGVMASAVTMDKLRTKLLWQGRGLPAGKFVWITREQ
MQSGLDATTEAAISALGLPLFVKPSSEGSSVGISRVNQLSDLPAALEEAFRHDDNVLVEA
FLSGEEYTVGILGDQILPAIKIKTASEFYDYEAKYISDDTQYFCPAGLSAEREAELQQLV
WSAWRALGCSGWGRVDVMTDDQGHFQLLEANTSPGMTSHSLVPMAAKQAGLTFSQLVVRI
LELAD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagttgccgttttaatgggcggcacgtcagccgagcgcgacgtgtccctgatg
tccggcggtgccgtgctggcgggcctgcgtgaagccggtatcgatgcacagggtattgat
acccgcgacgtttcagtgctggagttaaccgcgcaaggttttgaaaaagtgtttatcgcc
ctgcatggtcgcggcggcgaggacggcacgcttcaggcggtgctggaattcctgcagttg
ccttacaccggcagcggtgtgatggcttccgccgtcaccatggacaagttgcgcaccaaa
ctgctgtggcagggcaggggactgccggcgggtaaatttgtctggattacgcgtgaacag
atgcagagcggtctggatgcgacgaccgaggcggcgattagcgcattgggattacccctg
ttcgtgaaaccgagcagcgagggatccagcgtcggcatcagccgtgtaaaccagttaagc
gatctgccagctgcgctggaagaggcgtttcgccacgacgacaatgtgctggtcgaagct
tttctgagcggtgaggaatataccgttggcattctgggtgaccagattctgcccgcgata
aaaataaagaccgccagcgagttctatgactatgaagcgaaatacatttctgacgatact
cagtacttctgtccagccgggctgagtgccgagcgcgaggcggaattacaacagctggtg
tggtcagcctggcgtgcactcggatgcagcggctggggacgcgttgatgtcatgactgac
gatcaaggacacttccaactgctggaagcgaacacctcaccgggcatgaccagccacagc
ttagtgccgatggcggcaaagcaggccgggctgacattttctcaactggtcgtacgtatt
ctggagttggccgactga

DBGET integrated database retrieval system