KEGG   Pantoea ananatis AJ13355: PAJ_0150Help
Entry
PAJ_0150          CDS       T01969                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00061  Fatty acid biosynthesis
paj00780  Biotin metabolism
paj01100  Metabolic pathways
paj01212  Fatty acid metabolism
Module
paj_M00083  Fatty acid biosynthesis, elongation
paj_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAJ_0150 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PAJ_0150 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paj01004]
    PAJ_0150 (fabZ)
Enzymes [BR:paj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PAJ_0150 (fabZ)
Lipid biosynthesis proteins [BR:paj01004]
 Fatty acid synthase
  Component type
   PAJ_0150 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: BAK10230
UniProt: A0A0H3L0J0
LinkDB All DBs
Position
181198..181653
Genome map
AA seq 151 aa AA seqDB search
MTTETHTLQIEEILELLPHRYPFLLVDRVLDFEENKYLRAVKNVSFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDNARFKRPVVPGDQMIMEVTFEKT
RRGLTRFNGVATVDGKIVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgaaactcatactctgcaaattgaagagattttagagctgctgccgcaccgt
tatccgtttctgctggtagatcgcgtgctggattttgaagaaaacaaatatctgcgcgcc
gtaaagaatgtctcctttaacgagccgtttttccaggggcatttccctggtaaaccgatt
tttcccggcgttctgattctggaagcgatggcacaggccaccggcattctggcatttaaa
agcgtgggtaaactggagccaggcgagctttattattttgctggcattgataatgcccgt
ttcaagcgtccggtcgtaccgggcgatcaaatgattatggaagtgaccttcgagaaaacc
cgccgtggtctgactcgcttcaatggcgtagcgactgtcgacggtaaaatcgtctgtgaa
gcgaccatgatgtgtgcccgtagccgggaggcataa

DBGET integrated database retrieval system