KEGG   Pantoea ananatis AJ13355: PAJ_0856
Entry
PAJ_0856          CDS       T01969                                 

Gene name
phoQ
Definition
(GenBank) virulence sensor histidine kinase PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj01503  Cationic antimicrobial peptide (CAMP) resistance
paj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAJ_0856 (phoQ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PAJ_0856 (phoQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:paj01001]
    PAJ_0856 (phoQ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:paj02022]
    PAJ_0856 (phoQ)
   01504 Antimicrobial resistance genes [BR:paj01504]
    PAJ_0856 (phoQ)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PAJ_0856 (phoQ)
Protein kinases [BR:paj01001]
 Histidine kinases
  OmpR family
   PAJ_0856 (phoQ)
Two-component system [BR:paj02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   PAJ_0856 (phoQ)
Antimicrobial resistance genes [BR:paj01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    PAJ_0856 (phoQ)
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HisKA HATPase_c_2 HATPase_c_3
Other DBs
NCBI-ProteinID: BAK10936
UniProt: A0A0H3KV48
LinkDB
Position
complement(1014350..1015819)
AA seq 489 aa
MMSWFKRYRPISLRTRFLLASAAIVLILSLSYGMVAVIGYVVSFDKNTYRVMRGESNLFF
TLAQWKDNKLTIAQPERTMLNFPTLVFIYDEHGKLLWQQRDVPEIREKIQPEWLLKPDFY
EIDTNNSTSRAAMGDNLTAQQQLHAWDNDDDDQDTFTHSVAVNRYDATTNLPALTIVVVD
TIPQELQHSDVVWSWFSYVLAANLILIVPLLWLAAHWSLRPIGHLTLQVRELETGQRENL
DDNPPQELRSLVRNLNLLLTNERQRYTRYRTTLADLTHSLKTPLAVLQTTLRSLRGGKEL
TEEQAEPIMLEQISRISQQVGYYLHRASMQADHNPLQRDLHSVSGLLDSLCSALNKVYQR
KGVEITLDISPETTFFGDQNDFMEVLGNVLDNACKYCLEFIEVSAHQTDHALHLYIDDDG
PGIPESKRDMIFVRGQRADTLRPGQGLGLAVVRDILEQYAGKVIASSSPLGGARMEVVFE
RQEMEHRRE
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgatgtcctggtttaaacgctatcgccctatttcgctgcggacgcgcttcttactggct
tccgccgctattgtattaattctttccctttcttatggcatggttgcggtcattggctat
gtggtaagttttgataaaaatacctatcgcgtgatgcggggagaaagtaatttatttttc
acccttgcacagtggaaagataataagctcaccatcgcccagcctgagcgcacgatgctc
aatttcccaacgctggtatttatttatgatgaacacggcaaactgctctggcagcagcgc
gacgtgccggaaattcgtgaaaagatccaacctgaatggctgttgaagccggacttctat
gagatagataccaacaacagcaccagccgggctgcgatgggcgataaccttaccgctcag
cagcagctccacgcctgggataatgacgatgacgatcaggacacctttacccactcggta
gcggtaaaccgctatgacgcgacaaccaatctgcccgcgctgaccattgtcgtggtcgac
acgattccgcaggagcttcagcattccgatgtggtctggtcatggttcagctatgtgctg
gcggccaacctgattttaatcgttcccttgctctggctggcggcccactggagcctgcgt
ccaatcgggcatttaacgcttcaggtgcgcgagctggaaaccggacagcgtgaaaacctg
gatgacaatccgccgcaggagttacgctcgctggtgcgtaaccttaatctgctgctgacc
aacgaacgtcagcggtatacccgctaccgcaccacgcttgctgacctgacccatagcctg
aaaacgccgctggcggtgctgcaaactaccctgcgctctctgcgcggcggtaaagagctg
acggaggaacaagccgaaccgattatgctggagcagatcagccgcatttcgcagcaggtg
ggatattacctgcaccgcgccagcatgcaggccgatcacaatccgctgcagcgcgatctg
cattcagtgtccggtttgctggacagcttgtgttcagcgctgaataaggtttatcagcgc
aaaggcgtcgaaatcacgctggatatctcaccggaaaccaccttcttcggcgatcagaat
gacttcatggaagtgctgggtaacgtcctggataatgcctgcaagtactgcttggaattt
attgaagtcagcgcccatcagaccgaccatgccttgcatctttatatcgatgatgacggt
ccgggcattcctgaaagcaaacgcgatatgatatttgtgcgtgggcagcgcgccgatacc
ttacgtcccggtcaggggctggggctggcggtagttcgcgatattctcgaacagtatgcc
ggtaaggtgattgcctccagtagcccgttaggcggtgcgcgcatggaagtggtgtttgag
cggcaggaaatggaacatcgccgcgagtag

DBGET integrated database retrieval system