KEGG   Pantoea ananatis AJ13355: PAJ_1085Help
Entry
PAJ_1085          CDS       T01969                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [Cu-Zn] 2 precursor SodC
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
paj  Pantoea ananatis AJ13355
Brite
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PAJ_1085 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: BAK11165
UniProt: A0A0H3KZU2
LinkDB All DBs
Position
1297472..1297990
Genome map
AA seq 172 aa AA seqDB search
MKVKTIALLTLLTCGAAQAASEEVTIHEVSPQGIGKSVGTVKIEETQYGLQFTPMLAGLK
PGIHGFHVHAKGSCEPGESEGKTVAAGAAGGHLDPDNTGKHLGPYGEGHLGDLPALYVDD
QGKASYPMLAPRIKNLSEIKGKALMVHVGGDNHADHPKPLGGGGARFACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaaactatcgcgttgttgacgctgttaacctgcggcgcagcccaggccgcc
agtgaagaggtgacgattcatgaggtgtcgccgcagggtatcggcaaatctgttggcacg
gtgaagatcgaagaaacgcaatatggtttgcagtttacgcccatgctggcggggctaaaa
ccgggcatccacggcttccatgtccatgcaaaaggcagctgtgaaccaggtgaatcagag
gggaaaacggtggccgcgggcgcggcgggtggtcatctggacccggataataccggtaaa
catctcggaccctacggtgaaggtcacttaggggacctgccagcgctctacgtggatgac
cagggcaaggccagctatcccatgctggcaccccggatcaaaaacctgagtgagataaaa
ggcaaggcactgatggttcacgtgggcggcgataatcacgcggatcacccgaaaccgctc
ggcggcggcggggcacgctttgcctgcggcgtaatctga

DBGET integrated database retrieval system