KEGG   Pantoea ananatis AJ13355: PAJ_1202Help
Entry
PAJ_1202          CDS       T01969                                 

Gene name
xylA
Definition
(GenBank) xylose isomerase XylA
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00040  Pentose and glucuronate interconversions
paj00051  Fructose and mannose metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAJ_1202 (xylA)
   00051 Fructose and mannose metabolism
    PAJ_1202 (xylA)
Enzymes [BR:paj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PAJ_1202 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: BAK11282
UniProt: A0A0H3L3B2
LinkDB All DBs
Position
1443546..1444526
Genome map
AA seq 326 aa AA seqDB search
MSDLKFATRLNSFASGAHLYWPDLQGKPSVLQMVARAGKVKGLTHLDLNYPQHLTSDSKT
LRQAIEDAGLAVNGMQMRWDAPQFKIGAFTHPDPKIRREAIDLTKRGIDTGREFGSRLMT
LWMGQDGFDYCFQVDYKKIWEDAVSAVREIADYAPDVDVSIEYKPNEPRAYSIFPNVTTC
LLAVEEAGSPNLGITLDFAHVLFANEIPAWAAAMVARRSRLLGLDLNDGWGKRDDGLMAA
SVNPRATLEFLWQMQRDGYQGAYYFDTFPDASGLDPVREAETNIATVTRLLKLCDQLNDN
PALAEAISRQDAVASQQIVNDIMLAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttaaagtttgctactcgtcttaactcctttgcttcgggggcacatctctac
tggccagatttgcagggcaagccctctgtactgcaaatggtggcgcgcgcgggcaaggtt
aaaggcttaacgcatttggatctcaactatccccagcacctcaccagtgacagtaaaacg
ctgcgccaggctattgaggatgccgggctggcggtcaacggcatgcagatgcggtgggat
gcaccgcagttcaaaattggcgcatttacccatccggatccaaaaattcgccgtgaggcg
attgacctgaccaagcggggaatcgataccggacgggaatttggctcccgcttaatgacg
ttatggatgggtcaggacggtttcgactactgcttccaggtcgattacaaaaaaatctgg
gaagacgccgtcagcgcggtacgtgaaatcgccgactacgcgccggacgtggatgtgagc
attgaatacaaacccaacgagccgcgtgcctacagcatttttcccaacgtgaccacctgc
ctgctggccgtcgaagaggccggaagcccgaatctcggcatcacgctggatttcgcccat
gtcctgttcgccaatgaaattcctgcctgggcggcggccatggtggcgcgtcgttcccgg
ctgctggggctggatttaaacgacggctggggcaaacgtgacgacggactgatggcggca
tcggttaatccgcgcgccacgttggagtttctgtggcagatgcagcgtgatggttatcag
ggcgcctactattttgacaccttcccggatgccagcggactggatccagtacgtgaagcc
gaaaccaacattgccaccgtgacgcgattactcaagctttgcgaccagcttaatgataat
ccggcgctggcagaggcgatcagccgtcaggatgcggtcgcctcacagcaaatcgtcaac
gacattatgctggcgcgttaa

DBGET integrated database retrieval system