KEGG   Pantoea ananatis AJ13355: PAJ_1359Help
Entry
PAJ_1359          CDS       T01969                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00061  Fatty acid biosynthesis
paj00780  Biotin metabolism
paj01100  Metabolic pathways
paj01130  Biosynthesis of antibiotics
paj01212  Fatty acid metabolism
Module
paj_M00083  Fatty acid biosynthesis, elongation
paj_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAJ_1359 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PAJ_1359 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PAJ_1359 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paj01004]
    PAJ_1359 (fabI)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PAJ_1359 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PAJ_1359 (fabI)
Lipid biosynthesis proteins [BR:paj01004]
 Fatty acid synthase
  Component type
   PAJ_1359 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAK11439
UniProt: A0A0H3KW55
LinkDB All DBs
Position
1644186..1644995
Genome map
AA seq 269 aa AA seqDB search
MTIRITAMGFLSGKRILITGVASKLSIAYGIAQAMRKQGAELAFTYQNDKLKGRVEEFAK
DLGSDIVLPCDVAEDESIKSLFVELAKTWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGF
KIAHDISAYSFVAMAKECRAMLNPNSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYM
ANAMGPEGVRVNAVSAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLC
SDLAGGITGEIVHVDGGFSIAAMNELELK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccataaggattacagctatgggttttctttccggtaagcgcattctgattactggt
gttgccagtaaactttccatcgcctacggtattgcacaggcgatgcgcaaacagggcgca
gaactggctttcacctaccaaaacgacaaactgaaaggtcgtgtggaagagtttgccaaa
gatttgggttctgacattgtgctgccatgtgatgttgcagaagatgaaagcatcaaatcc
ctgttcgttgagctggcaaaaacctggccgaaatttgacggtttcgtgcactccattggc
ttcgcccctggcgaccagttggatggcgattacgtcaatgccgtaacccgcgaaggtttc
aaaatcgcacatgacatcagcgcctacagctttgttgcaatggcaaaagagtgccgtgcg
atgctgaaccctaactccgccctgctgacgctgtcttacctgggtgcagagcgcgctatc
cctaactacaacgtaatgggcctggcgaaagcgtcccttgaagcaaacgtccgttacatg
gctaacgcgatgggtcctgaaggcgtgcgtgttaacgccgtgtctgcgggtccgattcgt
accctggcggcatcgggcatcaaagacttccgtaagatgctggcccactgtgaagcggtt
accccgattcgtcgtaccgtcaccattgaagacgtgggtaactctgcggccttcctgtgt
tccgaccttgcgggtgggatcaccggtgaaatcgttcacgttgacggcggtttcagcatc
gctgcgatgaatgaactggaactgaaataa

DBGET integrated database retrieval system