KEGG   Pantoea ananatis AJ13355: PAJ_1412Help
Entry
PAJ_1412          CDS       T01969                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00240  Pyrimidine metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PAJ_1412 (tdk)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PAJ_1412 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: BAK11492
UniProt: A0A0H3L3V8
LinkDB All DBs
Position
complement(1709023..1709694)
Genome map
AA seq 223 aa AA seqDB search
MVKSALFFHRIRESAQMAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVYTAEIDNRF
GAGKVSSRIGLSSPAVLYNAASQLDVEIAQEHARQPVHCVLVDESQFLTREQVKALSDVV
DNLDIPVLCYGLRTDFLGELFTGSQYLLAWADKLVELKTVCHCGRKAGMVLRLDSDGKPF
REGEQVVIGGNERYISVCRKHYKKAIEQGCLQAIHGAQTPVGE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatcggccctgttttttcatcgtatccgagaatcggcgcaaatggctcaactc
tatttctactattcggcaatgaacgccggtaaatcaaccgcattattgcagtcatcctac
aattatcaggaacgcgggatgcgcacgctcgtctataccgctgagatcgacaatcgcttc
ggcgcaggcaaggtgagctcgcgtattggattatcttctcctgcggtgctttataatgca
gccagccagcttgatgtggaaattgcccaggaacatgcgcgacaacccgttcactgtgta
ctggtggacgaaagccagtttctgacgcgtgagcaggttaaggccttgtctgacgtggta
gataatctggatattcccgtactctgctacgggctgcgtaccgattttcttggtgaactc
ttcaccggtagccagtatcttctggcatgggcggataagctggtagagttaaaaacggtc
tgtcattgtggacgtaaagcgggcatggtgctgcgtctggacagtgacggtaaacctttc
agagagggggagcaggtcgtcatcggcggcaacgaacgctatatctccgtatgccgtaag
cattataaaaaggcgatagagcagggttgtttgcaggccatccatggggcgcaaaccccc
gtgggggaataa

DBGET integrated database retrieval system