KEGG   Pantoea ananatis AJ13355: PAJ_1706Help
Entry
PAJ_1706          CDS       T01969                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00250  Alanine, aspartate and glutamate metabolism
paj00280  Valine, leucine and isoleucine degradation
paj00410  beta-Alanine metabolism
paj00640  Propanoate metabolism
paj00650  Butanoate metabolism
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PAJ_1706 (gabT)
   00650 Butanoate metabolism
    PAJ_1706 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAJ_1706 (gabT)
   00280 Valine, leucine and isoleucine degradation
    PAJ_1706 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAJ_1706 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paj01007]
    PAJ_1706 (gabT)
Enzymes [BR:paj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PAJ_1706 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     PAJ_1706 (gabT)
Amino acid related enzymes [BR:paj01007]
 Aminotransferase (transaminase)
  Class III
   PAJ_1706 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAK11786
UniProt: A0A0H3KXK4
LinkDB All DBs
Position
complement(2060981..2062297)
Genome map
AA seq 438 aa AA seqDB search
MQNVLAEQQTYADNSQLLDVRDHNVPRGIITAHPLVIERAKGSEVWDVEGNRYLDFVGGI
GVLNVGHNHPAVVNAVTRQLGMVSHACFQVAAYPGYIELAQRLNKLVGGDEHYKSVFFTS
GAEAVENAVKIARSYTQRPGIIAFDGAFHGRTLLGVTLTGMSAPYKQNFGPFPGDVYRLP
FPNPLHGVTEADCLKALDQLFSVQILPERVAAIIIEPVQGDGGFLPAGPAFMQALRRITT
QHGIMLICDEIQSGFGRTGTMFAFQQLGIKPDMITTAKSLAGGLPISGVVGKAEIMDSPA
PGGLGGTYGGNALACAAALAVLDIFEQENLLARSCQLGEQLNQRLRQLADKYACIGDVRG
VGFMQAVEILDVDTHKPDSALTQKILDSACQEGLLLIKCGLHRNTIRFLAPLVTTDSQLE
EALHIFDIALARATGRLG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgtcctggcagagcagcaaacctatgcggacaacagccagttgctggatgtc
cgagatcacaatgtgccgcgtggcattattaccgctcatccgctggtgattgagcgagcc
aaaggcagcgaagtatgggatgtggaaggcaaccgctatctggattttgttggcggtatt
ggcgtccttaacgtaggccacaaccatccggccgtggttaacgccgtcacccgccaactg
ggcatggtgtcccatgcctgttttcaggtggcggcctatccgggatacattgagctggcc
cagcgtctgaataagctggtgggcggtgacgagcactataaaagcgtgtttttcaccagc
ggtgcagaagcggtagagaacgcggtgaaaatcgcccgttcttatacgcaacggccgggc
atcattgcgtttgacggggctttccacggacgtaccctgcttggcgtgacgctgacgggc
atgtctgcgccatacaaacagaattttggtccgttcccgggggatgtttatcgcctgccg
ttcccgaatccgttgcacggtgtgactgaggccgactgtctgaaggcacttgatcagctg
ttttctgtgcagattttgccggagcgcgtcgccgcgattatcatcgaacccgttcagggc
gatggcggcttcttacctgcaggtccggcatttatgcaggcgctgcgtcgtattactacc
cagcacggcattatgctgatctgtgatgaaattcagagcggctttggccgtactggtacc
atgtttgccttccagcaactcggcatcaaacccgacatgatcaccacggcgaagagcctg
gccggtggcttgccgatttccggcgtggtgggcaaagccgagatcatggacagtccggcc
ccgggcgggttgggcggcacctatggtggtaatgcgctggcctgtgcggcggcactggct
gtactggatatcttcgagcaggaaaacctgctggcgcgttcctgccagttgggcgagcag
ttaaaccagcgtctgcgccagcttgcggataaatatgcctgcatcggcgatgtacgcggc
gtgggctttatgcaggcagtagaaattctggatgtggatacccataaacccgacagcgcg
ctgacacaaaagatcctcgacagcgcctgtcaggaaggcctgctgctgatcaaatgtggt
ttgcatcgcaacaccatccgcttccttgcaccgttagtgaccaccgattcgcaactcgaa
gaagcgctgcatatctttgatattgcgctggcgcgtgcgaccggacgcttaggatag

DBGET integrated database retrieval system