KEGG   Pantoea ananatis AJ13355: PAJ_3018Help
Entry
PAJ_3018          CDS       T01969                                 

Gene name
yjjN
Definition
(GenBank) L-threonine 3-dehydrogenase YjjN
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00053  Ascorbate and aldarate metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    PAJ_3018 (yjjN)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     PAJ_3018 (yjjN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 3HCDH_N 2-Hacid_dh_C Pyr_redox_3 FAD_oxidored HI0933_like FAD_binding_3 UDPG_MGDP_dh_N FAD_binding_2 Sacchrp_dh_NADP adh_short Pyr_redox NAD_binding_7 GIDA NAD_binding_8 Thi4 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: BAK13098
UniProt: A0A0H3L5A8
LinkDB All DBs
Position
complement(3611562..3612647)
Genome map
AA seq 361 aa AA seqDB search
MPCHGKISHNCANDNGSLTMTTMKALVIAEPRNMVWTTRATPQPAPGEVLIKIVSAGICG
TDIHAWAGNQPFFSYPRVLGHELCANIVETGSAVEGFAVGQRVALIPYLSCYQCDACQSG
KTNCCEHISVIGVHQDGGFCDYLSVPASNLLAVDALAPEAAALIEPFAISAHAVRRAAVA
QGDAVLVVGAGPIGLGAAAIAAANGAQVIVADTSEYRRQHVSQQLGLPALNPADADFIAK
LRAGFNGQLALTLIDATGNPAAMNAAVNLIRHGGTVVYVGLHKGDLVIPDSEFHKKESTL
MGSRNATREDFDRVRELMAAGKLRADMMLNRRFAFSTLAEHFEEAVINNRELIKGVIDFD
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtcacggcaagattagccataactgcgctaacgataacgggagtcttaccatg
acaacaatgaaagcattagtcatcgccgaaccacgcaatatggtctggaccacgcgcgca
acgcctcaacccgcgccaggggaggtgctgattaaaattgtcagcgcgggcatctgcggc
acggatatccatgcctgggcgggaaaccaacctttttttagctatccacgggtactcggg
catgaactctgcgcaaacattgttgaaacaggcagcgccgtggaggggtttgccgttggc
cagcgcgtggcgctgatcccctatctctcctgttatcagtgcgatgcctgccaaagcggt
aaaaccaactgttgtgaacatatctcagttattggcgtacatcaggatggcggcttttgt
gactatctgagcgtgcctgcgtcaaacctgttggccgtggacgcgctggcacctgaggcg
gcggcgctgattgaaccctttgcgattagcgcccatgcggtaaggcgtgcggcggtggca
cagggcgatgccgtgctggtggtgggcgctggccctattgggctgggggcggcggccatc
gcggcggccaatggcgcgcaggtcatcgtggcggacaccagtgaataccgccgccagcac
gtcagtcaacagctgggtcttcccgcgcttaacccggctgacgccgatttcatcgccaag
ctgcgcgctggatttaacggtcagctggcgttaaccctgatcgatgccacgggcaacccg
gcggccatgaacgcggcggtgaacctgattcggcatggcggtacggtggtttatgtaggc
ctgcacaaaggcgacctggtcatccccgacagtgaattccacaaaaaagagagcacgttg
atgggcagccggaacgctacgcgcgaagattttgaccgggtgcgtgaactcatggccgcc
gggaaactgcgagcagacatgatgctgaatcgccgtttcgccttctctacgctggcagag
cattttgaggaagcggttatcaacaatcgtgagttgattaaaggcgttatcgattttgat
cgctaa

DBGET integrated database retrieval system