KEGG   Pantoea ananatis AJ13355: PAJ_3269Help
Entry
PAJ_3269          CDS       T01969                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase [Mn] SodA
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
paj  Pantoea ananatis AJ13355
Brite
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PAJ_3269 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAK13349
UniProt: A0A0H3L255
LinkDB All DBs
Position
3899964..3900596
Genome map
AA seq 210 aa AA seqDB search
MERKNMSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALEGTEFADLPVDE
LITKLDQLPADKKGPLRNNAGGHANHSLFWKGLKTGTALQGELKAAIEKDFGSVEKFQEE
FEKAATTRFGSGWAWLVKKGDKLAVVSTANQDNPLMGEAVAGVSGYPIIGLDVWEHAYYL
KYQNKRPDYIKAFWNVVNWDEAAARFASAK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggagaggaagaacatgagttattcactgccatccctgccttacgcctacgacgcactg
gaaccgcactttgacaagcagacgatggaaatccatcacaccaaacatcatcagacctat
gtcaacaacgccaatgcggcgctggaaggcactgaatttgctgatctgcccgttgatgaa
ctgatcactaagctggatcagctgccagcagacaaaaaaggcccgctgcgcaacaacgca
ggtggtcatgctaaccacagtctgttctggaaaggcctgaaaaccggcacggcccttcag
ggcgaactgaaggcggctattgagaaagattttggtagcgttgagaaattccaggaagag
tttgagaaagcggcgaccacccgtttcggttcaggttgggcctggctggttaaaaaaggc
gacaaactggccgtggtttccactgctaaccaggataatccactgatgggcgaggccgtc
gctggcgtttctggctatccgatcattggtttggatgtgtgggaacacgcctactacctg
aagtatcagaacaagcgtccggactacatcaaagcgttctggaacgtggttaactgggac
gaagcggcagcccgctttgcatcggctaagtaa

DBGET integrated database retrieval system