KEGG   Pantoea ananatis AJ13355: PAJ_3442Help
Entry
PAJ_3442          CDS       T01969                                 

Gene name
gst3
Definition
(GenBank) glutathione S-transferase III Gst3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PAJ_3442 (gst3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_3442 (gst3)
Enzymes [BR:paj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PAJ_3442 (gst3)
Transporters [BR:paj02000]
 Other Transporters
  Pores ion channels [TC:1]
   PAJ_3442 (gst3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_N_4 GST_C_3 Tom37 GST_C_2 GST_C_5
Motif
Other DBs
NCBI-ProteinID: BAK13521
UniProt: A0A0H3L2F9
LinkDB All DBs
Position
4126835..4127503
Genome map
AA seq 222 aa AA seqDB search
MMITVHHLEQSRSHRVLWMLEELEVPYQVKRYQREPTMLAPDALKKVHPLGKSPVITDGN
RVVAESGAILEYLEERYDSEKRLQLTDEEAQLQARYWLHYAEGSLMPLLVMKLVFGRLGS
APVPWLLRPVGAALGKGVQKAWLDKQLKLHKQVIEAHLSTQPWFAGQRFSIADVQMSFPI
LALSQRAGLKDAPATQKWLTTVQQRAAWQRAIQQGGEINLSG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcaccgttcaccatcttgaacaatcgcgctctcaccgggtgctgtggatgctg
gaagagctggaagtgccttaccaggtcaagcgctaccagcgcgaacccacgatgctggcg
ccggacgctttaaaaaaagtgcatccgttagggaagtcgcccgtgatcaccgatggcaat
cgcgtggtggccgagtccggtgccatccttgagtatctggaagaaagatacgacagcgaa
aaacggctgcagctcactgatgaagaggcgcagctacaggcgcgttactggctgcactat
gcggaaggttcactgatgccgctgctggtgatgaagctggtttttggccgccttggcagc
gcgccggtgccctggttgcttcgccccgtgggcgcggcgctgggcaaaggcgttcagaaa
gcctggctggataaacaactcaaattgcacaagcaggtcattgaagctcacctttcaaca
cagccgtggttcgcgggtcagcgcttcagcattgcggatgtgcagatgagtttccctatt
ctggcgctgagccagcgcgccggactgaaagatgcccccgctacgcaaaaatggttaacg
actgtgcaacagcgtgcggcctggcagcgcgctattcaacaaggcggtgagattaacctt
tctggctga

DBGET integrated database retrieval system