KEGG   Cutibacterium acnes SK137: HMPREF0675_3400Help
Entry
HMPREF0675_3400   CDS       T01215                                 

Definition
(GenBank) response regulator receiver domain protein
  KO
K07776  two-component system, OmpR family, response regulator RegX3
Organism
pak  Cutibacterium acnes SK137
Pathway
pak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pak00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF0675_3400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pak02022]
    HMPREF0675_3400
Two-component system [BR:pak02022]
 OmpR family
  SenX3-RegX3 (phosphate starvation response)
   HMPREF0675_3400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADD99377
UniProt: D4HB40
LinkDB All DBs
Position
complement(429491..430171)
Genome map
AA seq 226 aa AA seqDB search
MTRVLIIEDEESYREATAFMLRKEGFEVNTAANGADGLEIYSHNGADIVLLDLMMPGLPG
TEVCRQLRQRGNVGIIMVTARDSEIDKVVGLELGADDYVTKPFSHRELVARIRAVTRRGG
PEIEVSPDVLEESGVRMDVERHEVSVGGTAVRLALKEFDLLEVLLRNAGRVMTRASLIDR
VWGADYVGDTKTLDVHIKRLRAKIEDDPSRPVRIITVRGLGYKFQA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgtactcatcatcgaggacgaagagtcctatcgcgaggccaccgccttcatg
ctgcgcaaagagggatttgaggtcaatactgccgccaatggcgctgatggtctcgaaatc
tactcgcacaacggtgccgacatcgtactgctcgacctcatgatgccagggcttccaggg
accgaagtctgccgtcagctacgccagcgcggcaatgtcgggatcatcatggtgacggct
agggattcggagatcgacaaggttgtcgggctggagctcggagccgacgactacgtcacc
aaaccgtttagccaccgagaattggtcgcgcgcatccgcgctgtgactcgtcgcggcggc
cctgagatagaggtttcccccgatgtgctcgaggagagcggggtaaggatggacgttgag
cggcatgaggtcagcgtcggcgggacggcagtgcgacttgccctcaaagagttcgaccta
cttgaggtgctgctgcgcaatgcaggacgtgtcatgacccgagcctccctcatcgaccga
gtgtggggagccgactatgttggcgacactaaaactcttgacgtgcacatcaaaaggctg
cgcgcaaagattgaagatgacccatcccgtccggtgcgcatcatcaccgtacgcggactg
ggctacaagtttcaggcctaa

DBGET integrated database retrieval system