KEGG   Cutibacterium acnes SK137: HMPREF0675_3754Help
Entry
HMPREF0675_3754   CDS       T01215                                 

Definition
(GenBank) BNR/Asp-box repeat protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
pak  Cutibacterium acnes SK137
Pathway
pak00511  Other glycan degradation
pak00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    HMPREF0675_3754
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0675_3754
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:pak02042]
    HMPREF0675_3754
Enzymes [BR:pak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     HMPREF0675_3754
Bacterial toxins [BR:pak02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   HMPREF0675_3754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 Laminin_G_2 BNR_3 BNR Laminin_G_1 PSII_BNR
Motif
Other DBs
NCBI-ProteinID: ADE00360
UniProt: D4HCL0
LinkDB All DBs
Position
complement(770057..772372)
Genome map
AA seq 771 aa AA seqDB search
MTITDTYTEELAIDLTGSALMPARKGMDVQRIDGEDGSLLVEFSATSSGCLFELVGKNGR
LSVDVDEDRLLGRIDLNGESRSLDAEDALGMADGTIHSVGLTADETGTHLFADGYETFSA
TLRVWCQDLGATNIVINPSGVLDVRRFKMWNSALSLQAMAAKAPTATPFVEFAGSELSAR
DARRIGELAHGALRARTRLRGKGQGGTVLAAQGSAGELSFEIVNGDLLLHVEVDDEPIAH
VRAPGKWDDGNWHDLVAISGRGAIDLYVDGFLVAHEPGEAFFADLGKVERVTVGKDLEGA
RLFGEAQTASIFSSALTDAQVKRLANVAPLRTQALFDTGYLGSKSYRIPSLIRLDSGSFI
AGADQRVSIANDSPNDINFVIRRSEDGRRWDEAQIVLEYPGEGALGASVIDSVLFQDHNS
GRVFCLIDQFPGGVGQPNAEPGSGFDEQGRQLLFDRDATAYVIDAEGIVTTESGEPTDYT
VDETGNVFAAGAPAGNIHLATGVDPHESLLTLRTCNLILIHSDDDGRTWSRPINLNPALK
QPWMRFLGTSPGNGIQLEHGTHRGRLLAPVYYNHEEGKTFSCAAVYSDDGGQTWNLGKSP
NDERELFGKIVSSRNLNDDRGSTHESALVETPDGVVHSFMRNQHPSGRVAHAASVDGGET
WGEVTFVEQLTEIFSQPNAISVRDELGTESVVFANASMMLPFRGCGVLRQSFDGGKTWPH
NRVLNPRHHVYQCMTQQDEQTLLVLWEREWQGLFLTEVPLSWLTTSRSTLE
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactattactgatacttataccgaggaattggcgattgacctcactgggagcgccttg
atgccggcccgaaagggcatggacgtgcaacgaatcgacggcgaggacggctcacttctc
gtggaattcagcgcgacgtcctccggatgcctgttcgagcttgtcggaaagaacggacgg
ttatcagtcgatgtggatgaagaccgcttgcttggccgtatagatctgaacggagaatct
cgcagtctcgacgccgaggatgcgctgggcatggcagatggcacgattcactccgtcgga
ctcaccgccgatgaaactgggacgcatttgtttgcagacggttacgaaacattctccgcc
acattgcgggtatggtgccaggatctgggagcaaccaatattgtcatcaatccgtcgggc
gtcctcgacgtacggcgattcaagatgtggaactcagccctgtccttgcaagctatggcg
gccaaggcgccgacggcaacaccgttcgtcgagttcgctggttctgaactgtcggcccgc
gacgcacgccgtatcggagaactcgctcatggcgcgctccgagcaaggacccgtcttcgt
ggcaaaggccagggtggaaccgtcctcgcagcccaagggagcgccggtgaactgtccttc
gagatcgtcaacggcgacctgctcctgcacgtggaagtggacgatgaacccatcgcccac
gtgcgcgctccaggcaagtgggacgacggaaactggcatgacctggtagcaatcagtggc
cggggtgccattgatctctatgttgacggtttcctcgtggctcacgagcctggtgaggca
ttctttgccgatcttggcaaggtggaaagggtgaccgtcgggaaggacctcgaaggagca
cggctattcggggaagcacagacggcgtccatcttcagcagtgcgctaaccgacgcccaa
gtcaaacgcctagccaacgtggctcctctacgtacccaagctctcttcgacacgggatat
ctgggctcgaaaagttaccggatcccatcgctcatcagacttgattccggaagcttcatc
gccggggcagaccaacgtgtcagcattgccaacgacagccccaacgacatcaatttcgtc
atccgtcgcagcgaagacggtcgtcggtgggacgaggcccagatagtcctcgagtatccc
ggcgagggcgccctcggagcatcggttatcgactcagttctgttccaagaccacaactcg
gggcgcgtgttctgcttgatcgaccagttcccgggtggcgtggggcagcctaacgccgaa
ccagggtcgggcttcgatgagcaaggtcggcagcttctgttcgatcgcgatgcaaccgcc
tacgtcatcgatgcagaaggcatcgtaacaaccgagtcgggggaacccacggattacacc
gttgacgaaaccggaaacgtcttcgcagccggtgcccccgccggcaatatccacttggcc
accggagtggacccccacgagtccctgctgaccctacggacctgcaacctcatcctcatc
cacagtgatgacgacggacggacatggtcacgacctatcaacctgaacccggctctcaag
cagccttggatgcggttcctcggtacgtcaccgggcaacggaattcagttggaacacggg
acgcaccgaggccgactcctggcaccggtctactacaaccacgaggagggaaaaaccttt
tcatgtgccgcggtgtacagcgatgacgggggccagacatggaacctcggtaagtcaccg
aatgacgagcgcgaacttttcggaaagatcgtcagttctcgaaatctcaacgatgatcgc
ggctcgacccatgagtcagcgttagtagaaacccctgacggggtcgtgcactccttcatg
cgcaaccaacatccctccggacgggtggcgcacgcggccagcgtcgacggcggcgaaaca
tggggcgaggtgacgttcgtcgagcaactgaccgaaatcttctcccagcccaatgccatt
tctgtccgggatgagcttggaaccgaatcggtggtctttgccaatgcgtcgatgatgctc
ccgttccggggttgtggtgtgctgcgtcaaagtttcgacggaggcaagacctggccgcac
aaccgcgtgctcaaccctcgccatcatgtgtaccaatgcatgactcagcaagacgaacag
accctgctcgtattgtgggaacgggagtggcaaggcttgttcctgacagaggtcccgttg
tcatggcttaccacttcgcgcagcacgctggagtga

DBGET integrated database retrieval system