KEGG   Cutibacterium acnes SK137: HMPREF0675_4008Help
Entry
HMPREF0675_4008   CDS       T01215                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pak  Cutibacterium acnes SK137
Pathway
pak00020  Citrate cycle (TCA cycle)
pak00190  Oxidative phosphorylation
pak00650  Butanoate metabolism
pak01100  Metabolic pathways
pak01110  Biosynthesis of secondary metabolites
pak01120  Microbial metabolism in diverse environments
pak01130  Biosynthesis of antibiotics
pak01200  Carbon metabolism
Module
pak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0675_4008 (sdhA)
   00650 Butanoate metabolism
    HMPREF0675_4008 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HMPREF0675_4008 (sdhA)
Enzymes [BR:pak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HMPREF0675_4008 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     HMPREF0675_4008 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C NAD_binding_8 Pyr_redox GIDA Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ADE00428
UniProt: D4HDB1
LinkDB All DBs
Position
1033594..1035726
Genome map
AA seq 710 aa AA seqDB search
MNNWIEAVKKPLEMITGRHAGARPEEPGAELVKPEQLQPRRAESSSVARRAAKGPKARDI
LGPAQKKAGYLVGDELDGKAPEGDPLTAWTRRQSEYKLVNPANRRKMNVIVVGTGLSGSG
VAATLGQLGYHVDVFCFHDSPRRAHSVAAQGGINAARARKVDGDSLKRFVKDTVKGGDYR
GREADVVRLGTESVRVIDHMYAIGAPFAREYGGQLATRSFGGVQVSRTYYTRGETGQQLE
VACSQALQAQIDAGSVTMHNRTEMLDLIVADGKAQGIVTRDLLTGEIKAWTAHVVILCTG
GYGSVYHWSTLAKGSNATATWRAHRQGAYFASPCFVQFHPTALPVSSHWQSKTTLMSESL
RNDGRIWVPKKAGDDRPANDIPEEERDYYLERKYPAFGNLTPRDVASRNARTQIESGHGV
GPLKNSVYLDFRDAIERLGKKTIAERYGNLFDMYLDATGENPYEVPMRIAPGAHFTMGGL
WVDYDQMSTIPGLFVGGEASNNYHGANRLGANSLLSATVDGWFTLPLTVPNYLAGFVGKP
VLPLDAPEVSAAIERVQKRTDALLNCGGTHRPEWFHRKLGDILYEGCGVARDEAGLLDAL
TKVRELREEFWRDVKVVGTGNRLNQELEKAGRVADFIELGEVMILDALDRRESAGAHFRN
EYATEAGEAKRNDGDWCAVSAWETRPDGTKVRHSEPLSFSLIDLQVRDYR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaataactggattgaggccgtcaagaagcctctcgagatgattactgggcgtcatgcg
ggcgctagacccgaggagcctggcgctgaactagtgaaacccgagcagctccagcccaga
cgggctgagtcgtcgtcggtggcgagacgggctgccaagggtcccaaggctcgtgacatt
ctcggcccggcgcagaagaaggccggctaccttgttggtgacgaattggacggcaaggct
cccgagggggatccactcaccgcgtggacccgtcgtcaaagcgagtacaagctcgtcaat
ccggcgaaccgtcgcaagatgaacgtcatcgtggtgggaaccggcctctctggttccggg
gttgccgcaaccctcggccagctcggctaccacgtcgacgttttttgcttccacgattcc
ccgcgtcgagcccactcagttgctgcccagggaggtatcaacgctgcacgtgcccgcaag
gttgacggcgattcccttaagaggttcgtcaaggacaccgtcaagggtggtgactaccgg
ggccgagaggccgatgttgttcgactcggcaccgaatcggtacgggttattgaccatatg
tacgccatcggcgcgccgttcgcccgagaatatggcggtcagttggctactcgatctttc
ggaggcgtgcaggtttcgcgcacctactacacccgcggggagaccggtcagcagctcgaa
gtagcctgctcccaggccctccaggcacaaattgatgccggttcggtgacgatgcacaat
cgcaccgagatgcttgacctcatcgttgctgacggtaaggctcagggcatcgtcacccgt
gaccttctcaccggcgagatcaaggcatggacggcccacgtcgtcatcctatgcaccggc
ggatatggatcggtgtaccactggtccaccttggccaaagggtccaacgccaccgcgacg
tggcgtgctcaccgtcaaggtgcatacttcgccagcccctgcttcgtgcagttccacccg
accgcgctgcccgtcagttcgcactggcagtccaagaccacgctcatgagcgagtcgttg
cgcaacgacggccggatctgggtgcccaagaaagccggcgatgatcgtccagccaatgac
atcccggaagaggagcgcgactactatttggagcgcaagtacccggccttcggaaaccta
acgccgcgcgacgtcgcctcccgcaatgctcggactcagatcgagagcggccacggagtg
ggcccgcttaagaactcggtgtacctggatttccgtgatgccattgagcgtctaggaaag
aagacgattgccgagcgctatggcaacttgttcgacatgtatctcgacgccacgggggag
aatccctacgaggtgcccatgcgcatcgccccaggagcccattttacgatgggcggtctg
tgggttgactacgaccagatgagtaccatcccgggtctgttcgtcggtggtgaggcgtca
aacaactaccacggcgcgaaccgattgggggctaactccttgctgtcggccactgtcgac
gggtggttcaccctgccactgacggtgccgaactatttggctgggttcgtcggaaagccc
gtgttacccctggacgcccccgaggtcagcgcagccattgagagggtgcagaagcgcact
gatgccttgctcaactgcggcggaacacaccgcccggaatggttccaccgcaagctcggc
gacatcctctatgaggggtgcggggtcgcccgcgacgaggccgggctgctcgacgccctt
acaaaggtgcgcgagctgcgtgaggagttctggcgcgacgtcaaggtggtcggaacggga
aaccgactcaaccaggaactcgagaaggccggtcgagtggccgacttcatcgagctcggc
gaggtcatgattcttgacgccctggaccgccgggaatcggcaggtgcacacttccgtaac
gagtacgccaccgaagccggtgaagccaaacgtaatgacggtgactggtgtgcggtttcg
gcatgggagacacgtcctgatggcaccaaggtgcggcatagcgaaccgttgtcgttctcg
ttgatcgatctgcaggtgagggattaccgatga

DBGET integrated database retrieval system