KEGG   Cutibacterium acnes SK137: HMPREF0675_4009Help
Entry
HMPREF0675_4009   CDS       T01215                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pak  Cutibacterium acnes SK137
Pathway
pak00020  Citrate cycle (TCA cycle)
pak00190  Oxidative phosphorylation
pak00650  Butanoate metabolism
pak01100  Metabolic pathways
pak01110  Biosynthesis of secondary metabolites
pak01120  Microbial metabolism in diverse environments
pak01130  Biosynthesis of antibiotics
pak01200  Carbon metabolism
Module
pak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0675_4009
   00650 Butanoate metabolism
    HMPREF0675_4009
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HMPREF0675_4009
Enzymes [BR:pak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HMPREF0675_4009
    1.3.5.4  fumarate reductase (quinol)
     HMPREF0675_4009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_18 Fer4_16 Fer4_3 Fer4_15 Fer2 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ADE00308
UniProt: D4HDB2
LinkDB All DBs
Position
1035723..1036481
Genome map
AA seq 252 aa AA seqDB search
MRVELDIWRQNGPDAKGHFEHHVVEDAEPEWSLLELLDRLNDQIVENDGDPIVFESDCRE
GVCGCCGFMVNGKPHGPLPNTPACRQHLRAFPHITHFKIEPFRSAAFPVIRDLAIDRTSM
DHLIQAGGTVDVMTGTAPDADSVPQPHAEAEQALDFASCIGCGACVAACPNGAAMLFAGA
KLSHLAMMPQGRQERSKRARRMINALDEEFGPCSLYGECVEACPVSIPLVAVARVNRERW
RAGFRGAGSKDN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagggtggaactggatatctggcgtcagaacggccctgacgccaaaggacattttgag
caccacgttgtcgaagatgccgagccggagtggagcctgctggaattgctcgaccggctc
aacgatcagatcgtcgaaaatgacggtgatccgattgttttcgagtctgattgtcgtgag
ggagtgtgcgggtgctgtgggttcatggtcaacggcaagccccatggtccgctgccgaat
accccggcgtgtcgtcagcatttgagggcattcccccatatcacccatttcaaaattgag
ccattccgctcggcagcctttccggtcatccgtgacctagccatcgaccgtacgagcatg
gatcacctgatacaggccggtggaacggtcgacgttatgacgggcacggcccctgatgca
gattcggtgccgcagccgcatgccgaggccgagcaagctctcgacttcgcatcgtgtatt
ggatgcggagcgtgcgtggcggcttgtccaaatggcgcggcgatgcttttcgccggcgcg
aagctgtcgcacttggcgatgatgccgcaggggcgtcaggagcgttcgaagcgtgcgcga
cgcatgatcaacgcccttgatgaggagttcggtccgtgttccctgtatggcgagtgcgtt
gaggcctgcccggtgagcattccgttggtagccgtcgcccgggtcaaccgggagcgttgg
cgtgccggattccggggagcaggcagtaaggacaactga

DBGET integrated database retrieval system