KEGG   Cutibacterium acnes SK137: HMPREF0675_4047Help
Entry
HMPREF0675_4047   CDS       T01215                                 

Definition
(GenBank) MFS transporter, SP family
Organism
pak  Cutibacterium acnes SK137
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-ProteinID: ADE00563
UniProt: D4HDE7
LinkDB All DBs
Position
1071354..1072769
Genome map
AA seq 471 aa AA seqDB search
MKPGDSGSAGATRNSQTSWAVFIAVTAAALGITYGYDISNTAAALQFVQRDFGIYSAINT
ASVVGQIAGAILGGPMANAIGRKKSMLVIAAGYTIFAILTAISPSAGLFLAMRVLLGITI
GLSITVVPVFIAESAPASRRGGLATAYQVTCVVGIILGYLVGYSLLPTDTWRWILGVAAV
PAFIVLLMLVRTQETPSWYMLKGREDEARRAMERIEVAELVEPSLDEIRNSLSSRPSGSV
WGRLREMFHGGMARATIFAIVLGFSIQITGINATIYYAPGIYSRMGFTDTATTYLVPSLV
QFLSLISVVISMLVIDKVGRRFVLITGISTMIVATIVLIMTYLASGFEGAVAGIIGLVGM
SLFTMGFTFGFGSIVWVYAGEIFPARYRSLGASLVLTADLIANAITAQLGAAMLDGIGLA
GTFGVYGGLLVVALLFLLRYAPETSGRSLEEIQDYWNNGARWPKADSPSMG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctggtgattccgggtcagctggtgcgacgagaaatagtcagacgagctgggcc
gtcttcattgcggtgacggcagcagccctgggaatcacttatggttatgatatttctaat
accgcggccgctttgcaatttgtacagcgagactttggtatctatagcgccatcaacacg
gcctccgtggtaggtcaaatagcaggtgccattcttggcggccctatggcgaatgccatc
ggacgtaagaagtcaatgctggttatcgcggctggatatactattttcgctatcctgaca
gcaatctccccgtccgctggactgttccttgctatgcgggttctgttgggtatcactatc
gggctttccattaccgtcgtgccggtgtttatcgccgaatccgctccggcgtcgcggcgg
ggcgggctggcaaccgcgtatcaagtgacgtgcgtcgtcggaatcatcttggggtacctc
gtcggttattccctgctgcctacggacacgtggcgttggattctcggtgtcgcagccgtc
ccagcatttattgtgctcctgatgcttgttcgcacccaggaaaccccctcctggtacatg
ctcaaggggcgtgaagatgaggctcgtcgtgccatggagcgcatcgaggttgctgaattg
gttgagccgagcctcgatgagatccgcaactcgttgtcttctcggccctctggatctgta
tgggggcggttgcgtgagatgttccatgggggcatggctcgtgccacgatctttgctatc
gttctgggattttcaatccagatcactggaattaatgcaacaatctattatgcgcctgga
atctattcgcgaatgggatttactgacactgcgacaacctatctggtgccatccttggtg
cagttcctatcattgataagtgttgtcatctcgatgctcgttattgataaggtagggcgt
cgattcgttcttatcacgggaatatctacgatgattgtagcgactatcgtgctcatcatg
acatatttggcgagtggttttgaaggtgctgttgccggtattattggcctcgttgggatg
tccctttttactatggggtttactttcggtttcggttccatcgtatgggtttacgcgggt
gagattttcccggctcgctaccgctcactcggtgcatctctggtgcttacggcagacttg
atcgcgaatgcgatcactgcccaattgggagctgcgatgctcgacggtatcgggctggca
ggaacattcggggtctacggtgggctcctcgtcgttgcgctgctattcctgctgaggtac
gccccggaaacgtccggtcgctcgcttgaggagatccaggactattggaacaacggtgct
cggtggcccaaggctgactcgccttcgatggggtga

DBGET integrated database retrieval system