KEGG   Candidatus Phytoplasma australiense: PA0213Help
Entry
PA0213            CDS       T00752                                 

Gene name
gyrB
Definition
(GenBank) DNA gyrase beta subunit
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
pal  Candidatus Phytoplasma australiense
Brite
KEGG Orthology (KO) [BR:pal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pal03032]
    PA0213 (gyrB)
   03400 DNA repair and recombination proteins [BR:pal03400]
    PA0213 (gyrB)
Enzymes [BR:pal01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     PA0213 (gyrB)
DNA replication proteins [BR:pal03032]
 Prokaryotic type
  DNA Topoisomerases
   PA0213 (gyrB)
DNA repair and recombination proteins [BR:pal03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      PA0213 (gyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: CAM11548
UniProt: B1V9B6
LinkDB All DBs
Position
250087..252075
Genome map
AA seq 662 aa AA seqDB search
MKNYNADSIQILEGLEAVRKRPGMYIGSTAAKGLHHLVWEIVDNSIDEALAGHANEITLE
ILPGDIISVTDNGRGIPVGIHHKTGKPAVETILTTLHAGGKFDSSSYKISGGLHGVGASV
VNALSSWFSVEIHLDKKIHYQKYEKGVPVAPLEVIGKTDRKGTVIKFLADPSIFQETTIY
DAKILKERIQQLSFLNKGLKLNLIDQRQEKPVSFNFYHEKGLQDYLTFINQTYMQKPFHN
LFVLEKELDNLALEIVFEYTVNDDEKSKQQEEEQAIKNYTQTQKIYSFVNNIHTHEGGTH
EEGFKLALSRNFSKYAKDYNLLKKNESLLSEDILEGITAIISLKHQDPQFEGQTKAKLGN
VEVRQIVSQYFGEALGRFLLENPGDAKKIIEKCLLSANARLAAKRAREIVRNKPLDTLGF
AAKLADCRSKDPKISELYIVEGDSAGGSAKQGRDSHFQAILPLKGKVLNVEKTQSSKILT
NKEIKSLIQAIGIGVDINKQKNLNLDKLRYHKIIIMTDADVDGAHIRTLLLTFFFRNLRI
LIEKGYIYFARPPLYKYQKGKNITYFYEEKEKIDFSLKKNIKDGFQRYKGLGEMNPDQLW
ETTMNPEKRTLLQASLKDALNALSDEEAIKEANSTFNILMGKEVFPRKEFILNNALEADL
DV
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaattacaacgcagacagtattcaaattttagagggtttggaagcagttcgtaaa
agaccaggaatgtatatcggctctactgctgctaaaggattacatcatttagtttgggaa
attgttgataattccattgatgaagctttagcgggtcatgcaaacgaaatcactttagag
attttacccggagacatcattagtgtaactgataacggtagaggaattcctgtagggatt
caccacaaaacaggtaaaccagcggtagaaaccattttaactactttgcacgcaggagga
aaatttgacagctcttcttataaaatttcgggcggtcttcatggagtgggagcctctgtt
gtaaatgctttatctagttggtttagtgttgaaattcatttggataaaaaaatccattat
caaaaatatgaaaaaggggtccctgttgctcctttagaagttattggtaaaacagaccgc
aaagggacagttattaaatttttagctgatccttccatttttcaagaaactactatttac
gatgccaaaattttgaaagaacgcatccaacaattatcttttttaaataaaggacttaaa
ttaaatttaattgaccaaagacaagaaaaacctgtaagctttaatttttatcacgaaaaa
ggcttgcaagattaccttacttttattaatcaaacttatatgcaaaaaccttttcataat
ctttttgttttagaaaaagaacttgataatttggctttagaaattgtttttgaatacact
gttaatgatgatgaaaaaagtaaacaacaagaagaagaacaagcaattaaaaattacact
caaactcaaaaaatttattcttttgttaataacatccacactcatgaaggcggaacacat
gaagaaggttttaaattggctttaagtaggaatttttctaaatatgctaaagattataat
cttttaaaaaaaaatgaaagtttattaagtgaagatattttagaaggaatcactgcaatt
atttctttaaagcaccaagatccacaattcgaaggacaaactaaagctaaattaggcaat
gttgaagtaagacaaattgtttctcaatattttggtgaagctttaggaagatttttatta
gaaaatccaggtgatgctaaaaaaattatcgagaaatgtttactttctgcaaacgctcgt
ctagctgcaaaaagagcgcgtgaaattgtaagaaacaagccgcttgatactttaggtttt
gctgctaaattagctgattgccgtagcaaagatccaaaaatttctgaactttatattgtc
gaaggagattctgcaggaggttctgctaaacaaggaagagattctcattttcaagcaatt
ttgcctttaaaagggaaagtgttaaacgttgaaaaaactcaatcttccaaaattttaact
aacaaagaaatcaaatccttaattcaagcaattggcataggtgttgatatcaataaacaa
aaaaacctcaacttagataaattacgttatcataaaattattattatgaccgatgcggat
gttgatggtgctcacattagaaccttgcttttaactttctttttcagaaatttaaggatt
ttaattgaaaaaggttatatttatttcgcaagacctccattatataaatatcaaaaaggt
aaaaatattacttatttttacgaagaaaaagagaaaatcgatttctccctcaaaaaaaat
attaaagatggttttcaaagatataaaggattaggtgaaatgaatccggaccaactttgg
gaaactacaatgaatcctgaaaaacgaacacttttacaagcctctttaaaagatgcttta
aatgctttaagcgacgaagaagcgatcaaagaagcaaattcaacttttaatatcttgatg
ggtaaagaagtttttccaagaaaagaattcattttaaataatgctttagaagcggattta
gatgtttaa

DBGET integrated database retrieval system