KEGG   Providencia alcalifaciens: CO695_03685Help
Entry
CO695_03685       CDS       T05107                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pala  Providencia alcalifaciens
Pathway
pala00564  Glycerophospholipid metabolism
pala01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pala00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CO695_03685
Enzymes [BR:pala01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CO695_03685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N GIDA Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-ProteinID: ATG15449
UniProt: A0A291E833
LinkDB All DBs
Position
810423..811925
Genome map
AA seq 500 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLESQDLASATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLRLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRVSLPSS
KSLKFNQNSVLKPELTKGFEYSDCWVDDARLVVLNAQEVVRKNGEVRTRTKVTRAYRENG
LWIVEAQDLRTGETLTWKAKGLVNATGPWVKEFFDDGLKLKSPYGIRLIKGSHIVVPRAH
DEPQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKDVKIDEKEVNYLLKVYNDHF
KKQLTKQDIVWDYSGVRPLCDDESDSPQAITRDYTLDIHDEDGKAPLLSVFGGKLTTYRK
LAEAAVGKLATYYPHATGPWTKNGQLPGGDIEGCDRDGYARVLTQHYPWLPEGLALRYAR
TYGSNSKLILAGANSLSDLGEAFGANVYEAELRYLVENEWVVELDDAIWRRTKLGMWLND
AEKQRIAQWLAEHTKVAVTA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaaagacttgattgtaattggcggcggaatcaacggcgctggtattgcggca
gatgccgcggggcgtggattatctgtactgctgcttgaatctcaagacttagcgagtgca
acttcatctgcaagttcgaaactgatccacggtggattacgttacctcgaacattatgag
tttagactcgttagtgaagcgcttgctgagcgtgaagtcttgttacgactggcgccacac
atcgcattcccaatgcgctttcgtctacctcaccaaccacatttacgcccagcttggatg
atccgtattggtctgttcctatatgatcatttaggcaaacgcgttagcttaccaagtagc
aaaagtttaaagttcaaccaaaattctgtgcttaaaccagaattaaccaaaggtttcgaa
tactcagattgctgggttgatgatgcgcgtttggtggtattgaacgctcaagaagtggta
cgtaaaaacggtgaagttcgcactcgcaccaaagtgacccgcgcatatcgcgaaaatggt
ctatggattgttgaagcgcaagacttacgtactggcgaaacgcttacttggaaagccaaa
ggactggtcaacgcaacgggtccttgggtaaaagagttcttcgatgacggcttaaaactg
aaatccccttatggtattcgtctgatcaaaggcagccatattgtggttccacgcgcccac
gatgaaccgcaagcgtacattttacaaaacgaagataaccgaattgtcttcgtgatccct
tggatggatgagttctccattatcggtaccaccgatgttgagtacaaaggggatccaaaa
gatgtgaaaattgacgaaaaagaagtcaattatctgctgaaagtgtataacgaccacttc
aaaaaacagctgaccaaacaagatattgtgtgggattactccggtgttcgccctctgtgt
gatgacgaatcagattctccacaagcaatcactcgtgactacactttagatattcacgat
gaagatggtaaagccccattactgtcagtatttggtggtaaattaaccacttatcgtaaa
ctggctgaagccgctgtgggtaaattagcgacatattatccacatgcgacaggtccttgg
accaaaaatggtcaattacccggtggtgacatcgaaggttgcgaccgtgatggttatgca
cgagtattaactcaacattacccttggcttccggaaggtctagcactgcgttacgcaaga
acatacggcagcaacagtaagctgattttagcaggcgcaaactcactgtcagatttaggc
gaagctttcggtgcaaacgtctatgaagctgaattacgttacttagtcgaaaatgagtgg
gttgtagaattagacgatgcgatttggcgtcgtaccaaattgggcatgtggctgaacgac
gctgaaaaacagcgcattgcacaatggctggcagagcacactaaagtggctgtgaccgca
taa

DBGET integrated database retrieval system