KEGG   Providencia alcalifaciens: CO695_05245Help
Entry
CO695_05245       CDS       T05107                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pala  Providencia alcalifaciens
Pathway
pala00250  Alanine, aspartate and glutamate metabolism
pala00410  beta-Alanine metabolism
pala00430  Taurine and hypotaurine metabolism
pala00650  Butanoate metabolism
pala01100  Metabolic pathways
pala01110  Biosynthesis of secondary metabolites
pala01120  Microbial metabolism in diverse environments
pala02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CO695_05245
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CO695_05245
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CO695_05245
   00430 Taurine and hypotaurine metabolism
    CO695_05245
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CO695_05245
Enzymes [BR:pala01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CO695_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ATG15741
UniProt: A0A291E9D6
LinkDB All DBs
Position
complement(1158298..1159698)
Genome map
AA seq 466 aa AA seqDB search
MNNKSVSSKYSELDDIYASLDLSQSLPKSKFPTKESDPRNVFSAVRDELMLDGNSRQNLA
TFCQTWVDDEIRSLMDLSIDKNMIDKDEYPQTAEIENRCVHMLADLWHSPDALNTLGCST
IGSSEAAMLGGLALKWQWRKKQAAKGKPTDKPNLICGPVQICWHKFARYFDVELREIPLE
GDRLIMSPEEVIKRVDENTIGVVPTLGVTFTCQYEPVKAVHDALDKLQKETGLDIPIHVD
GASGGFLAPFCAPTLEWDFRLPRVKSINASGHKFGLAPLGAGWVVWREAKDLPEELIFNV
NYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIHNACYATAQYLAREIEKLGPF
EMIFDGDSAKGIPALAWKLKDGVKNSNYSLYDIADKLRSRGWQVPAYSMPANREDLVIQR
ILVRHGVSLDLASLLIEDFKRTLEYFEKHPVSTPLSEEESGGFNHS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaatcagtatcttcaaaatatagtgaattagatgatatctatgcatcactt
gatttatcccaatcattaccaaaatcgaaattcccaaccaaagaaagcgacccacgaaat
gtctttagtgcggtgcgtgatgagttaatgctagatggtaattcccgacaaaacttagcg
acattttgccaaacatgggttgatgatgaaatccgcagtttgatggatctctctatcgac
aaaaacatgattgataaagatgaatatccacaaactgccgaaattgaaaatcgttgtgtg
catatgctagccgatttatggcactcccctgatgcactcaatacattaggttgttcaacc
attggttcttctgaagcggcaatgttgggcggtttagcgttaaaatggcaatggcgtaaa
aaacaagccgccaaaggaaaaccgaccgataaacccaatttaatttgtggtccagtacaa
atctgctggcataaatttgcgcgttattttgatgtcgaactgcgtgagatcccactggaa
ggcgaccgcctgattatgagccctgaagaggtcatcaaacgtgtcgatgaaaacactatc
ggtgttgttccaacattaggtgtgaccttcacttgccaatatgaacccgtaaaagccgta
catgatgcactggataaactgcaaaaagagacgggcttagatattcctattcacgtggat
ggggcaagtggtggtttcctcgcacctttctgcgcgccgacattggaatgggatttccgt
ttaccacgcgtcaaatccatcaacgcttctgggcacaaattcggtttagcgccattaggt
gctggctgggttgtttggcgtgaagcgaaagatctccctgaagagctcattttcaatgtg
aactaccttggcggtaatatgccaactttcgccttgaacttctctcgtcctggtgggcaa
attattgctcaatactacaatttcctacgccttggtcgcgaaggctacgcaaaaattcat
aatgcgtgttatgccaccgctcaatatctcgcccgtgaaattgaaaaactgggtccattt
gagatgatttttgatggcgatagtgccaaaggtatccctgcacttgcatggaaattaaaa
gatggcgtaaaaaacagtaactactctttatacgatattgctgacaaattacgtagtcgc
ggttggcaagttcctgcctactcaatgcctgcaaaccgcgaagatctggttatccaacgt
attctcgtccgtcatggtgttagcctagaccttgcctcattactcattgaagacttcaaa
cgtactctcgaatatttcgagaaacacccagtcagtacaccactttctgaagaagaaagc
ggtggattcaatcacagctaa

DBGET integrated database retrieval system