KEGG   Providencia alcalifaciens: CO695_06245Help
Entry
CO695_06245       CDS       T05107                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pala  Providencia alcalifaciens
Pathway
pala00790  Folate biosynthesis
pala01100  Metabolic pathways
Module
pala_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pala00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CO695_06245
Enzymes [BR:pala01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CO695_06245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ATG15913
UniProt: A0A291E9G7
LinkDB All DBs
Position
1346876..1347724
Genome map
AA seq 282 aa AA seqDB search
MHIKARGRLLDLSTPQVMGILNVTPDSFSDGGTHNRYHDALDHVAKMVQAGATIIDIGGE
STRPGAAEVSISEELDRVVPVVDAIAKRFDVWISVDTSKAQVMDEAAKVGMHIINDIRSL
HEAGSLEVAARLGLPVCIMHMQGQPRTMQDAPNYVDVVKDVKDYLAGEIERCVAAGIDKQ
QIILDPGFGFGKNLSHNYQLLAHLDQFHDFGLPLLAGLSRKSMIGQLLNVPPQERLAGSL
ACATIAAMQGAQIIRVHDVKETVQAMQVVQMTLSEKEKLAYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcatattaaagcccgaggtcgcctccttgacttatcaacccctcaagtgatggggatt
ctgaatgttactcctgactcattttcagatggtggcactcataatcgttatcacgatgcc
ctcgaccatgttgctaaaatggtccaagccggtgcaacaattattgatatcggcggcgaa
tcaactcgaccaggtgctgctgaagtttcgattagtgaggagctcgatcgtgttgtaccc
gtggtagacgctattgcaaagcgttttgatgtgtggatttctgtcgacacttcgaaagct
caagttatggatgaagccgcaaaagtaggtatgcatattattaatgacattcgttcacta
catgaagcaggttcccttgaagtggctgcaaggctggggctaccagtgtgtattatgcat
atgcaaggtcagccgagaacaatgcaagatgcaccaaattatgtggatgttgtcaaagac
gttaaagattatcttgccggtgaaattgaacgctgtgtggcggcgggaattgataaacag
caaataatcctcgatccaggctttggttttggcaagaacttgtcgcataattaccagcta
ctagcgcatttagatcaatttcatgatttcggactaccgctcttggcaggactgtcacgg
aaatctatgattggacaattattaaatgttccacctcaagaacgtcttgcgggcagctta
gcttgtgccaccattgcggcaatgcaaggggcacaaattatccgagttcatgatgtgaaa
gagactgtacaagcaatgcaagtcgttcagatgactctgtcagaaaaggaaaaattagcg
tatgagtaa

DBGET integrated database retrieval system