KEGG   Providencia alcalifaciens: CO695_08880Help
Entry
CO695_08880       CDS       T05107                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
pala  Providencia alcalifaciens
Pathway
pala00270  Cysteine and methionine metabolism
pala00450  Selenocompound metabolism
pala01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pala00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CO695_08880
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CO695_08880
Enzymes [BR:pala01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     CO695_08880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Met_gamma_lyase Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ATG16398
UniProt: A0A291EBD6
LinkDB All DBs
Position
1897492..1898682
Genome map
AA seq 396 aa AA seqDB search
MSLDIKRSFETRAIHSHYNSQDHLGSLASPIYQTSTYVFKSVEEGAAYFSGEKDGYIYTR
INNPTLSLLENRISSLEEGEAAIVFSSGMGAITSTFWSLLNPGDELLVDLTVYGCTYAFF
HHGLARFGVKVRHIDMSEPENLAQAITENTRMIFFESPANPNMRLVDIAAVSQIAHQHNI
LVAVDNTYCTPYIQKPLVLGADIVLHSLTKYMNGHGDAMGGAVITTAERAKHIRLVGLKD
MTGACLSPHDANLIIRGLKTLSVRMDRIVQSTQKIAEYLEAHPQVVAIMYPGLPSFEQYQ
LAQKQMELAGGMIAFELKGGLEAGKRFLNHLTLFSRAVSLGDCESLAQHPASMTHSTYTP
EERQQYGISDGLIRLSIGLENVDELIADIHQALSVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagatataaaacgttcttttgaaacacgggcgatccatagtcattataattca
caggatcatttaggctctttagcttcacctatctaccaaacatcgacttatgtgtttaaa
agtgtagaagaaggcgctgcctattttagcggtgaaaaggatggctatatttatacccga
attaataacccaacattaagtctattagaaaatagaatttcctctcttgaggagggagag
gcggctattgtgttctcctctggtatgggcgcaattacctcaacgttttggtcattatta
aatccgggtgatgagctgttagttgatctaactgtttatggttgtacttatgcctttttt
catcatggattggctcgatttggtgtgaaagttcgtcatattgatatgagtgagccggaa
aatttggcacaagcaattactgaaaatacgcggatgatattctttgagtcgcctgctaac
ccgaacatgcgcttagtggatattgctgcggtgagccaaattgctcatcagcataatatt
ttagtagcagtcgataacacttattgcacaccgtatattcaaaaaccactggttcttggt
gcagatattgttctgcactcattaactaagtacatgaatggtcatggcgatgcgatgggg
ggagcggtgatcaccaccgcagagcgtgcgaagcatataagattagtgggcttgaaagat
atgacaggggcgtgtttatctcctcatgatgcgaatctgattatccgagggcttaaaacc
ttgtctgttcgtatggataggattgtccaaagtacacaaaaaattgctgaatatttagaa
gcgcacccgcaggtggtggcaattatgtaccctggcttaccgagttttgagcagtatcaa
ttagctcaaaaacagatggaattagcgggaggaatgattgcctttgaactgaaaggggga
ttggaggcaggtaaacggtttttaaatcatttaacactgttttcacgtgcagttagctta
ggagattgtgagtcattagcacagcatccggcaagtatgacccactccacctatacaccg
gaagaaaggcaacaatatggtattagtgatggattgatccgtctttctattggcttagaa
aatgtggatgagttgattgccgacattcatcaagcactcagtgttgagtaa

DBGET integrated database retrieval system