KEGG   Providencia alcalifaciens: CO695_13850Help
Entry
CO695_13850       CDS       T05107                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pala  Providencia alcalifaciens
Pathway
pala00473  D-Alanine metabolism
pala01100  Metabolic pathways
pala01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pala00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CO695_13850
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CO695_13850
Enzymes [BR:pala01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CO695_13850
Peptidoglycan biosynthesis and degradation proteins [BR:pala01011]
 Precursor biosynthesis
  Racemase
   CO695_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Spherulin4
Motif
Other DBs
NCBI-ProteinID: ATG18333
UniProt: A0A291EG96
LinkDB All DBs
Position
2942950..2944173
Genome map
AA seq 407 aa AA seqDB search
MSFRLRYLALLPLLVATACQQPAKTNIIETSSAQVQPAVINNSWIEISHSALDYNIKKVQ
TLLGDKAGLCAVLKGDSYGHDLTLVTPVMIENNVQCIGLTSNTEFKQVRDLGFKGRLMRV
RNATEKEMAQATEFHVEELIGNLDMAQRLNAIGAKQNTIIPIHLALNSAGMSRNGLEVSN
AEGLQQAKLISQLPNLKIVGIMSHYPEEDEAQIRQDLAKFKKQSQQVLKMTGLKREDVTL
HVANTYATLTVPESWLDMVRVGGIFYGDTIATKDYKRVMTFKSNIAAVNHYPKGNTVGYD
RTYTLKRDSVLANIPVGYADGYRRVFSNAGHVLINGQRVPVFGKTSMNTVMVDITDLKNV
QPGDEVVFFGKQGNGEITAEEVEEISGALFTEMSILWGATNKRILVN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatttcgtcttagatatcttgctcttttgcctttgctggttgcgacagcctgccag
caacccgcgaaaaccaacatcattgaaacctcatcagcacaagttcaacccgcggtcatt
aataattcgtggatagaaatttcgcacagtgcgttggattacaatatcaagaaagtgcaa
acattattgggtgataaagcggggttgtgcgccgttttaaaaggggattcctatgggcat
gatttgacgctcgtcacaccagtgatgattgagaataatgtccaatgcattggattaacg
agtaatacagagtttaagcaggttcgtgatttaggctttaaaggtcgtttaatgcgagtg
cgtaacgccactgagaaagaaatggctcaagcgacggaatttcatgtagaagaactcatt
ggtaacttggatatggcgcagcgcttaaatgcgattggggcgaaacaaaacaccattatt
cctattcatcttgcattgaattcagccggtatgtcgcgcaatggattagaggttagcaat
gctgagggattacaacaagctaagctaatttcgcagttaccaaatttaaagattgtcggg
attatgtcgcattacccagaagaagatgaagcgcaaattagacaggatctggctaagttt
aaaaaacagtctcaacaagtgttaaagatgacagggctaaagcgtgaggacgtgacactg
catgtggcgaatacttatgcaacattaacggtaccggaatcgtggttagatatggtacgt
gttggtggcattttttatggtgacactattgcgaccaaagattacaaacgtgtcatgacg
tttaaatcaaatattgcggctgttaatcattatccgaaaggaaatacagtgggttatgat
agaacttacactttgaagcgtgactcagtgttagccaatatacctgttggttatgcggat
ggatatcgtcgtgtcttcagtaatgctggccatgtattgattaatggtcaacgtgtgccg
gtttttgggaaaacatccatgaataccgtaatggtagacattactgaccttaaaaatgtt
cagccaggggatgaggttgtcttttttggtaaacaaggcaatggagaaattaccgctgag
gaagttgaagagattagcggtgctttgtttacagaaatgtccattttgtggggagccaca
aacaagcggattcttgtgaattaa

DBGET integrated database retrieval system