KEGG   Providencia alcalifaciens: CO695_14320Help
Entry
CO695_14320       CDS       T05107                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pala  Providencia alcalifaciens
Brite
Enzymes [BR:pala01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CO695_14320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ATG17417
UniProt: A0A291EEA2
LinkDB All DBs
Position
3042695..3043228
Genome map
AA seq 177 aa AA seqDB search
MKFKLCLLATLFTASAAYAAQTTVELKEATAKGDGKAIGEVVISETEYGLLFTPKLSGLQ
AGGVHGFHVHENPSCDPGEKEGKTVPALKAGGHLDPAKTGVHKGPYDKTGHLGDLPGLVV
DSQGNATYSVLAPKLKSLKDIQNRALMVHAGGDNYSDHPEVLGGGGARMACGIIPSS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaaattatgtttgttagcaacattattcacagccagcgcggcatatgcagca
caaaccacggtagagctaaaagaagcgacagccaaaggtgatggtaaagccattggcgaa
gtggtgatttctgaaaccgaatacggattactcttcactccaaaactctctggattacaa
gcgggaggcgtgcatggcttccatgtgcatgaaaacccaagttgcgacccaggggaaaaa
gagggcaaaacagttccagcattaaaagcgggtgggcatttagaccccgcgaaaacagga
gtacacaaaggaccttatgataaaacaggtcatcttggagatttaccgggcttagtggtt
gatagccaaggcaatgcaacctacagcgtccttgcaccaaaattaaaatccttgaaggat
atccagaaccgagcattaatggtgcacgcaggtggggataattattcagatcatccagag
gtgttaggcggtgggggggctagaatggcctgcggcatcattccttcgtcataa

DBGET integrated database retrieval system