KEGG   Providencia alcalifaciens: CO695_14740Help
Entry
CO695_14740       CDS       T05107                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pala  Providencia alcalifaciens
Pathway
pala00473  D-Alanine metabolism
pala00550  Peptidoglycan biosynthesis
pala01100  Metabolic pathways
pala01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pala00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CO695_14740
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CO695_14740
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CO695_14740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pala01011]
    CO695_14740
Enzymes [BR:pala01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CO695_14740
Peptidoglycan biosynthesis and degradation proteins [BR:pala01011]
 Precursor biosynthesis
  Amino acid ligase
   CO695_14740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: ATG17497
UniProt: A0A291EEI2
LinkDB All DBs
Position
complement(3136200..3137303)
Genome map
AA seq 367 aa AA seqDB search
MSKIRVGVIFGGKSTEHEVSLQSAKNIINGLDRSKFDVCLIGINKEGQWHEYDEANFLLH
GDDPAHIALNTPKRSIAIVPGKQSEQFISLEDAKPLPQIDVIFPIVHGNLGEDGSLQGLL
RMANLPFVGPGVLGSSACMDKDVTKRLLRDAGLHIAPFITILKSGRDEISYSATVEKLGL
PLFIKPANQGSSVGISKVNNESEFNAALDFAFLFDVKVLIESAVKGREIECAVLGNEHPL
ASPCGEIVLHDSFYAYHTKYIDENGASVVAPADLEHDISDKIRAIALEAYQALNCSGMSR
VDVFLTENNDVVINEINTLPGFTNISMYPKLWQQGGMTYQELISRLIELGIEKFEQTAAL
KTACDEI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaattcgggttggtgtcatttttggtggaaaatctaccgagcatgaagtttcg
ttgcaatcagctaaaaatattattaatggattagaccgtagtaaatttgatgtatgcctg
attggtattaataaagaagggcaatggcatgagtatgatgaagcaaacttcctgctacat
ggtgatgatcctgctcatattgcgttaaatacaccaaaacgcagtattgcaattgttcct
ggtaaacagagtgaacaattcatttctttagaagatgcaaaaccgctcccgcaaattgat
gttatttttccaatcgtccacggtaacttaggtgaagatggttctttgcaagggttgttg
cgtatggcgaatctaccttttgtaggtccgggtgttttaggttcttccgcatgtatggat
aaggatgtcactaagcgcctactaagagatgccgggttacatattgcaccatttatcacg
atattaaaaagtgggcgtgatgaaatcagctactcagcgacggttgaaaaactgggctta
ccattatttattaaacctgctaaccaagggtcatcagttgggatcagtaaagttaataat
gaaagcgagtttaacgcggcattagattttgcatttttatttgatgtaaaagtgctgatt
gaaagcgcagtgaaaggtcgtgaaattgagtgtgcagtgcttggaaatgagcatccactt
gcaagcccatgtggcgaaattgtgttgcatgatagcttctatgcttaccatactaaatat
attgatgaaaatggagcatccgttgttgccccagcagatctagagcatgatattagtgat
aaaattcgggcgattgcgctagaagcatatcaagcattgaattgcagtggtatgtcccgt
gttgatgtgtttttaacagaaaacaacgatgttgtgattaatgaaatcaatacattacca
ggatttactaatatcagcatgtatccaaagttatggcagcaaggtggcatgacttatcaa
gaattgatcagccggttaattgagctgggaattgaaaaattcgagcaaacagcggcttta
aaaacggcctgcgatgaaatttag

DBGET integrated database retrieval system