KEGG   Providencia alcalifaciens: CO695_14850Help
Entry
CO695_14850       CDS       T05107                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pala  Providencia alcalifaciens
Brite
KEGG Orthology (KO) [BR:pala00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CO695_14850
Enzymes [BR:pala01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CO695_14850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_binding_3 DAO AlaDh_PNT_C Thi4 NAD_binding_8 K_oxygenase Glutaredoxin FAD_oxidored FMO-like
Motif
Other DBs
NCBI-ProteinID: ATG17518
UniProt: A0A291EEM6
LinkDB All DBs
Position
complement(3158732..3160306)
Genome map
AA seq 524 aa AA seqDB search
MLDNNLQAQLKAYLERLTKPVELVSNLDDSAKSIEIKQLLEQIASLSDKVTVREEHDSTQ
RTPSFLITNPGTSIGVRFAGSPLGHEFTSLVLALLQVGGHPSKEAQELLDQVKGLEGDFN
FETYYSLSCHNCPDVVQALNLMAVLNPNVRHTAIDGALFQNEIDERNIMGVPAVFLNGKE
FGQGRMTLSEIVSKVDTNADARAAKAISEREPFEVLIIGSGPAGASAAVYTARKGIRTGV
IGERFGGQVMDTVDIENYISVLKTEGAILAGALKNHVDSYNVDVIDGQSVTKLIPAEQIG
GYHQIETASGGVMKARSIIIATGARWRNMGVPGEQEYRTKGITFCPHCDGPLFKGKRVAV
IGGGNSGIEAAIDLAGIVEHVTVLEFASELKADSVLQEKARSLSNIDIILNAQTLEVKGD
GSKMTSLEYKDRTDESVHSLEVAGAFVQIGLLPNTNWLGDTVARNRMGEIEVDARNETSV
KGVFAAGDCTTVPYKQIIISAGDGAKAALSAFDYLIRTSTRTAE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataataatttacaggctcaattaaaagcctatctagaaagattaactaaacct
gtagaactggtttcgaatttagatgacagcgcaaaatcaattgaaataaaacaattactt
gaacaaattgcgtcgctgtcagacaaggtgactgtacgtgaagagcacgactccacccaa
agaacaccttcatttttaattaccaacccagggactagtattggcgtgcgttttgcaggc
tcaccattgggtcatgaatttacgtctttagtgctggcgctactgcaagtgggtggtcat
ccatccaaagaagcccaagaattattggaccaagtgaaagggcttgaaggcgatttcaac
tttgagacttattattcattatcttgccataattgccctgatgtcgtgcaggcgttgaac
ttgatggcagttttgaatccgaacgttcgccatacggcgattgatggtgcgctgttccaa
aatgaaatcgatgaacgcaacatcatgggtgttcccgctgttttcttaaacggcaaagaa
tttggtcaaggtcgcatgacattaagcgaaatcgtgagcaaggttgataccaatgccgat
gcgcgtgcggcaaaagcgattagcgaacgtgaaccctttgaagttttaatcatcggtagt
ggtccggcgggtgcatcagccgcagtttatactgcacgtaaaggcatccgtactggcgtc
atcggtgagcgtttcggtggacaggtgatggataccgttgatatcgaaaactatatttcg
gtattgaaaacagaaggcgcaattttagcgggtgccctgaaaaatcatgtagatagctat
aatgtcgatgtaattgatggtcaatcagtcactaagcttatccctgctgagcaaattggc
ggttatcaccaaatcgaaacggcatcaggcggcgtgatgaaagcacgcagtattatcatc
gcaaccggtgctcgctggagaaatatgggcgtaccgggtgagcaagagtaccgtacaaaa
gggattacattctgcccacactgtgatggtccattgtttaaaggtaagcgtgtagccgtc
attggcgggggtaactccggtattgaagccgctatcgacttagcgggtatcgtcgaacat
gtcactgtattggagttcgcatcagaattaaaagctgactcagtattacaagaaaaagcg
cgtagcttgagtaatatcgacatcattttgaatgcacaaacccttgaagttaaaggggat
ggcagcaaaatgactagcttagagtacaaagaccgtaccgatgaaagtgtgcattctttg
gaagtggcaggtgcatttgttcagattggtttattaccaaataccaattggttaggggat
accgttgcacgtaaccgtatgggtgaaattgaagttgatgcccgtaatgaaaccagtgtg
aaaggcgttttcgccgcaggtgactgtacaacagtgccttacaaacaaattatcatttca
gccggagacggtgcaaaggccgcacttagcgcctttgattaccttatccgcacaagtacc
agaaccgctgaatag

DBGET integrated database retrieval system