KEGG   Providencia alcalifaciens: CO695_17260
Entry
CO695_17260       CDS       T05107                                 

Definition
(GenBank) bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
pala  Providencia alcalifaciens
Brite
KEGG Orthology (KO) [BR:pala00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pala03009]
    CO695_17260
Enzymes [BR:pala01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     CO695_17260
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     CO695_17260
Ribosome biogenesis [BR:pala03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CO695_17260
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 Methyltransf_31 Methyltransf_25 THUMP Methyltransf_11 MTS Methyltransf_15 Methyltransf_24 N6_Mtase
Other DBs
NCBI-ProteinID: ATG17961
UniProt: A0A291EFP3
LinkDB
Position
complement(3658827..3660935)
AA seq 702 aa
MNFLFASTARGLEELLKTELEALGASQCKVAQGGVYFQADDRVMYQSLLWSRLASRILLP
LNDFDVYSDLDLYLGVQAIDWSEIFDVNDTFVVHFTGTNEEIRNSQYGALKVKDAIVDSF
VRKLDQRPDVARQEADIRINVYLNKERASVALDLSGDSLHIRGYRDLAGQAPLKETLAAA
IISRSGWQKNTPMVDPMCGSGTLLIEAAMIAADRAPGLYRQHWGFNAWLKHNPELWREVV
TEAQVRFRQGLKDTTSRFYGFDIDKRVLDMARANARRAGLQDLITFNHGDAAALENPVKT
DIKGTIISNPPYGERLESEPALIALHSQFGRVVKARFPGWRLSIFSASPELLSCLQLRSE
REFKAKNGPLDCVQKNYQLAETPSETVAEISPDFANRLRKNQKKLAKWAKQQGVDCYRLY
DADLPEYNVAVDIYGEKVVVQEYAPPKTVDERKARQRLFDVITATMNVLGLTSNQLVLKT
RQRQKGKQQYEKLAQKDDFFLVQEYNAKLLVNLTDYLDTGLFLDHRIARRMLGEMSRGKD
FLNLFCYTGTATVHAGLGGAKSTTSVDMSRTYLEWAEKNLQANQLTGRQHRLMQADCLNW
LANADEQFDLIFIDPPTFSNSKRMDGTFDVQRDHVQLITHLKRMLRRGGTVMFSNNKRGF
KMDLEALTELGLKAQEITAKTLSEDFARNRQIHNCWLISHAE
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgaattttctgtttgccagcacagctcgaggcctggaagaactactgaaaactgaattg
gaagcgctaggcgctagccagtgcaaagtggcacaagggggcgtctattttcaggctgat
gaccgtgtgatgtatcaaagtctgctatggagtcgactggcatctcgtattttattaccg
ctgaatgattttgatgtctatagtgatcttgatttatatctgggtgttcaagcgattgat
tggtctgaaatcttcgatgtgaatgatacatttgtagtgcatttcacgggaaccaacgaa
gaaatccgtaatagccaatacggtgcattaaaagtaaaagatgccatcgttgacagcttt
gtgcgtaagttggaccaacgccctgatgtggctcgccaagaagccgatattcgcattaac
gtttatctgaacaaagaacgcgcgagtgttgcactcgacttgagtggcgattcactgcat
attcgtggctatcgtgatttagccggacaagccccattaaaagagacgttagccgccgct
attattagtcgttccggttggcagaaaaataccccaatggtcgacccaatgtgtggttcg
ggtacattattaattgaagcggcaatgattgctgcagatagagcgccaggtttataccgt
cagcattggggatttaatgcatggttgaagcacaatcctgaattatggcgtgaagtggtc
actgaagcgcaagttcgttttcgtcaaggtttaaaagacacgacttcacgtttttatggt
tttgatatcgataaacgtgtgctggatatggcgcgagcgaatgcccgtcgagcagggtta
caagatttgatcacctttaatcatggtgatgccgctgcattggaaaacccagtcaaaacc
gatatcaagggcactattattagcaacccgccatacggcgaacgtttggaaagtgagcca
gcattaatcgcattacatagccaattcgggcgggtggttaaagcacgtttccctggttgg
cgtttatctattttcagcgcatctcctgaattattaagctgcttacaattacgttctgaa
cgtgaatttaaagccaaaaatggcccattggactgtgtacagaaaaactaccaattagca
gaaactccgtcagaaacggtggctgagatttctcctgattttgctaaccgcttgcgtaag
aatcagaaaaaactggcaaaatgggcgaaacagcagggcgtggattgctaccgtttgtat
gatgcagatttaccggaatacaatgtggcagtggatatctacggtgagaaagttgtcgtc
caagaatatgcaccaccaaaaactgttgatgagcgcaaagcgcgtcagcgcttatttgat
gtgatcaccgcgacgatgaacgttcttgggttgacctcaaatcaattagtattgaaaacc
cgtcagcgtcaaaaaggtaaacagcagtacgaaaaattagcgcaaaaagatgatttcttc
ttagtgcaggaatataacgctaaattgttagtgaatttaactgactacctagatacaggg
ttattcctcgaccaccgtattgcccgccgcatgttaggtgaaatgagccgtggtaaggat
ttcttaaatctattttgttataccggcactgcgactgttcatgcgggtctgggtggcgct
aagagcaccacgtctgttgacatgtctcgtacctatttagaatgggcagagaaaaactta
caagcaaaccaacttaccggtcgtcaacaccgcttaatgcaagcagattgcttaaactgg
ttagctaatgccgatgagcaatttgacttaattttcatcgacccaccgacgttctcaaac
tcaaaacgtatggatgggacatttgatgttcaacgtgaccatgtgcagctgattacacat
ctgaaacgcatgctgcgtcgtggtggaacagtgatgttctcgaacaataagcgtggattc
aaaatggatcttgaagcactgactgagcttggcttaaaagcacaagaaattactgctaag
acactgtcagaagatttcgcacgtaaccgtcaaattcacaactgctggttgattagccac
gcagagtaa

DBGET integrated database retrieval system