KEGG   Paenibacillus albus: EJC50_00435Help
Entry
EJC50_00435       CDS       T06567                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
palb  Paenibacillus albus
Brite
KEGG Orthology (KO) [BR:palb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EJC50_00435 (ahpF)
Enzymes [BR:palb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EJC50_00435 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_3 HI0933_like Thi4 FAD_binding_2 DAO NAD_binding_7 K_oxygenase Glutaredoxin NAD_binding_8 NAD_binding_9 FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AZN38311
LinkDB All DBs
Position
106003..107535
Genome map
AA seq 510 aa AA seqDB search
MVLDQEIKAQLNQYLALMEGDVLIKVSAGDDEVSKQMLELTDAFASMSSRIKVEKADLLR
TPSFSVNRPGEETGIVFAGVPLGHEFTSLVLALLQVSGRAPKVEQDVIERIKNVQGVYRF
ETYISLSCHNCPDVVQALNLMSVLNPGITHTMIDGAVYKAEVESKNIMAVPSVFLNGEFF
GGGRMTIDEILDKMGLKRDDSALFNKETYDVLVVGGGPAGASAAIYSARKGIRTGIVADR
FGGQVVDTVSIENFIGVKYTEGPKLAASLEEHVKEYNVDVMKLQRATRLEKNGEFVEVEL
ENGAVLKSKTVILSTGARWRNIDVPGEEEFKNKGVAYCPHCDGPLYAGKRVAVVGGGNSG
VEAAIDLAGICSHVTVLATASELKADAVLQDRLYSLSNVTVLTNVQTKEITGTDKVNGIS
YTERETGAEKHVELEGVFVQIGLVPNTEWLGDDIERTDSGEIVVDKRGATSLPGVFAGGD
CTDSAYNQIIISMGSGATAALSAFDYLIRH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtattagatcaggaaattaaggcacaattaaaccaataccttgccttgatggaaggc
gacgttctgattaaggtcagcgcaggcgacgatgaagtgtcgaaacagatgcttgagctg
acggatgcttttgccagcatgtcttcccgaattaaggtcgaaaaagcggatttgctgaga
acaccaagctttagcgtgaaccggccaggtgaggaaacaggaatcgtgttcgcgggcgta
ccgctcgggcacgaattcacgtctctcgtgcttgcattgttgcaagtcagcggcagagcc
cctaaagttgagcaggatgtgatcgaacggatcaagaacgtccaaggtgtgtaccgcttc
gagacgtacatcagcttaagctgccataactgtccggacgtcgttcaggcgctgaaccta
atgagcgttcttaaccccggcattacgcatacgatgattgacggtgcggtttacaaagca
gaggtcgagagcaagaacatcatggccgttccgtccgtattcttgaacggtgaatttttc
ggcggcggccgcatgacgatcgacgagattttggacaaaatgggcttgaagcgcgacgac
tcggcgttgttcaacaaagagacttacgacgtgctcgttgtcggtggaggcccagcaggc
gcgagtgcagctatctactccgcgcgtaaaggaattcgtactggtatcgtagcggaccgc
ttcggcgggcaagtcgtcgatacagttagcatcgagaatttcatcggcgtgaagtatacg
gaaggaccaaagctcgcagcaagtctcgaggagcatgtgaaagaatataacgtcgatgtg
atgaagctgcagcgcgcgacacgcctcgagaagaacggggagttcgtggaagttgagctg
gagaacggcgcagtgctgaagagtaagaccgttattctgtccactggcgcacgctggcgc
aatatcgacgttcccggcgaagaggaattcaagaataaaggcgtcgcttattgcccgcat
tgcgacggtccgctctacgctggcaagcgcgtagccgtagtcggtggaggcaactccggc
gtcgaggctgccatcgatctcgcaggtatctgcagccatgtcaccgttctggcaaccgct
tcggaattgaaggcggacgccgtgctgcaagatcgcctgtacagtctctcgaacgtcact
gttcttacgaacgtgcaaacgaaagaaattaccggaacagataaagtgaacggcatctcc
tatacggagcgcgaaacaggcgccgagaagcatgtggagcttgaaggtgtattcgtccaa
atcggacttgtcccgaataccgaatggcttggggatgacattgagcggacggactccgga
gaaattgtcgtagacaagcgcggcgcaactagcttgccaggcgtatttgccggcggcgat
tgcacggacagcgcgtacaaccagattattatctcaatgggctcaggcgcaaccgcggcg
cttagcgcctttgattatctcattcgccattaa

DBGET integrated database retrieval system