KEGG   Pseudomonas alcaligenes: A0T30_04565Help
Entry
A0T30_04565       CDS       T04318                                 

Definition
(GenBank) dATP pyrophosphohydrolase
Organism
palc  Pseudomonas alcaligenes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitMHS TrkA_C DctM
Motif
Other DBs
NCBI-ProteinID: AMR65683
UniProt: A0A142IN01
LinkDB All DBs
Position
complement(997659..999449)
Genome map
AA seq 596 aa AA seqDB search
MPWDSLPLLFVAALLVWVLYAFVREKWSPDIVAAIAVAALLISQLLEPKEVLSVLSNSAP
VTIACMFVLSAALERTGCIDALGNWLGELVGTSPIRVLTGLTVTALVISAFLNNTPVVAI
LTPVAISLARRAGTLPSKLLIPLSYATILGGTLTMIGTSTNILVDGVARKAGLEPFGIFE
ITGAGLILAAAGMAYMLTIGRRLLPERETLSKQLRPDLDRTFMSELLVPHDSPMIGKTLA
EANLNGGSGLQVLKIFREEAELTEPGHDTVLAAGDQLVIHGQVKDVVELRGSGHLSFNRG
EAFETISSHDVVLAEAIVGRNSRYSNRPMRDLDLTARYGIAVLAVHRQDENVSGNLDEFQ
LQFGDVMLVEGTPAQIKRFADNGELISLNTVQERSFRRDKAPIAIIATLAVMLLAAFGVM
PIEGLAIIGAVTVLATRCLDVEDAYKAVDWKILSLIFGMLAISIAMDKVGLVKLLVENVM
GWLPWAGPLLMLSFIYLFTSILTEVLSNNAVAVLVTPIAIGMAQHLGVDPRAFVVAVMFA
ASASFATPIGYQTNTFVYNAGGYRFTDFMKVGIPLNLILWVVASFVIPWFWPLVPV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgccctgggactcattgcctctactgttcgttgccgcactgctggtgtgggtgctctat
gccttcgtccgcgagaagtggagtccggacatagtcgccgccatcgccgtggccgccttg
ttgatcagccagttgctggagcccaaggaggtcctgagcgtactgagcaactcggcgccg
gtgactatcgcctgcatgttcgtgctgtccgccgccctggagcgcaccggctgcatcgac
gcactcggcaactggctgggcgaactggtcggcaccagcccgatccgcgtgctcaccggg
ctgacggtgacggccctggtgatctcggccttcctcaacaacaccccggtggtggccatc
ctcaccccggtggcgatttccctggcgcgccgcgccggcaccctgccgtccaagctgctc
atcccgctgtcctacgccaccatcctcggcggcaccctgaccatgatcggcacctcgacc
aacatcctggtcgacggcgtggcgcgcaaggccggcctggagcctttcggtatcttcgag
atcactggagccggcctgatcctggccgccgccggcatggcctacatgctgaccatcggc
cgccgcctgctgcctgagcgcgaaaccctgtccaagcagctgcgcccggacctggaccgc
accttcatgagcgaactgctggtgccgcacgactcgccgatgatcggcaagacgctggcc
gaggccaacctcaatggcggcagcggtctgcaggtactgaagatcttccgcgaagaggca
gaactgaccgagccgggccacgacaccgtgctcgccgccggcgaccagctggtgatccac
ggccaggtcaaggatgtggtggaactgcgcggcagcggacacctgagcttcaatcgcggc
gaagctttcgaaaccatctccagccacgacgtggtgctggccgaagccatcgtcgggcgc
aactcgcgctacagcaaccgccccatgcgcgacctcgacctcaccgcacgctacggcatc
gccgtgctggccgtgcatcgccaggacgaaaatgtctccggcaacctggacgaattccag
ctgcagttcggcgacgtcatgctggtcgaaggaacgccagcgcagatcaagcgctttgcc
gacaatggcgaactgatcagcctcaacaccgtgcaggaacgctccttccgtcgcgacaag
gcgcccatcgccatcatcgccaccctggcggtgatgctgctggccgccttcggcgtgatg
cccatcgaaggcctggcgatcatcggcgcggtcaccgtgctggccacccgctgcctggat
gtcgaggacgcctacaaggcggtggactggaagattctcagcctgatcttcggcatgctg
gccatcagcatcgccatggacaaggtgggcctggtcaagctgctggtggaaaacgtcatg
ggctggctgccctgggccggcccgctgctgatgctgagcttcatctacctgttcacttcg
atcctgaccgaagtgctgtcgaacaacgccgtggccgtactggtcacaccgattgccatc
ggcatggcccagcacctgggcgtcgacccgcgcgccttcgtggtcgcagtgatgttcgcc
gccagcgccagcttcgccacacccattggttaccagaccaacaccttcgtctacaacgca
ggcggttatcggttcaccgacttcatgaaggtcggcattccgctcaacctgattctctgg
gtggtggccagcttcgtcattccctggttctggccgctggtgccggtataa

DBGET integrated database retrieval system