KEGG   Pseudomonas alcaligenes: A0T30_05110Help
Entry
A0T30_05110       CDS       T04318                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
palc  Pseudomonas alcaligenes
Pathway
palc00550  Peptidoglycan biosynthesis
palc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:palc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0T30_05110
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A0T30_05110
Enzymes [BR:palc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A0T30_05110
Peptidoglycan biosynthesis and degradation proteins [BR:palc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A0T30_05110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AMR65786
UniProt: A0A142INA4
LinkDB All DBs
Position
1128690..1130615
Genome map
AA seq 641 aa AA seqDB search
MPQPIRLKDHEKDARLVRRRVVVGGVVVLLLTCVLIARMYYLQVIQYEHHTTLAENNRIH
VQPIPPTRGLIFDRNGVIIADNRPSFSLTITRERAGDWRQVLDAIVEVLELTPDDRALFE
KRMRQGRRPFEPVPVLFELSEEQIARIAVNQFRLPGVEVSAQLVRHYPLKERFAHSVGYV
GRINEKELKDLDPTDYAGTHHIGKTGIERFYEDMLHGQVGYEEVETNARGRVLRVLKRTD
PTPGMDLTLSLDVRLQEAAEQALAGRRGALVAIEPSTGDVLAMVSLPSFDPNPFVTGIGF
KAYAELRDSIDRPLYNRVLRGLYPPGSTIKPMVAVAGLDAGVITPQTRVFDPGYYQLPGH
SHKYRNWNRLGDGSVNMEFAIMRSNDTYFYDLARKMGVDRLHDYMTRFGLGQKVALDMFE
EAPGLMPSREWKRARYRQAWYPGETLILGIGQGYMQTTPLQLAQATALMATRGKWIRPHL
LKTAEGQTPQQLMADGAMDGVMTPPDIVLRDDKFWDYGRLGMEAVMHGPRGTAAKVGATS
VYRIAGKSGTAQVVAIKQGEKYDRSKVRERHRDHALFVAFAPAEAPKIAVAVMVENGESG
SGVAAPVVKQVMDAWLLGPDGQLKPEYRPPVPVTEEASVQR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagccgatccgcctgaaggaccacgagaaggacgcccgcctggtgcgtcgtcgc
gtcgtcgtcggcggcgtcgtggtgctgctgctgacctgcgtgctgattgcccgcatgtac
tacctgcaggtgatccagtacgagcatcacaccaccctggcggagaacaaccgcattcac
gtgcagccgattccgcccacccgtgggctgatcttcgaccgcaatggggtgatcatcgcc
gacaaccgccccagtttcagtctgaccatcacccgcgagcgggcgggcgactggcgccag
gtgctggatgcgatcgtcgaggtgctggagctgaccccggatgaccgcgcgctgttcgag
aagcgcatgcgccagggacgccggccgttcgagccggtgccggtgctgttcgagctgtcc
gaggagcagatcgcgcgcattgcggtcaaccagttccgtctgcccggggtggaagtcagt
gcccagctggtgcgtcactatccgctgaaggagcgcttcgcgcattcggtcggctatgtc
gggcggatcaatgagaaggagctcaaggacctcgatcctaccgactacgcgggcacccac
catatcggcaagaccggtatcgagcgcttctacgaggacatgctgcacggccaggtcggt
tacgaggaagtcgagaccaacgcccgtggccgggtactgcgggtgctcaagcgcaccgat
ccgacgccgggcatggacctgaccctgagcctcgacgtgcgtctgcaggaggcggccgaa
caggcactggccggccgccgtggcgccttggtggcgatcgaaccgagcacgggcgacgta
ctggcgatggtcagcctgcccagcttcgaccctaaccccttcgtcaccggcatcggcttc
aaggcctatgccgagctgcgcgactccatcgaccggccgctgtacaaccgcgtgctgcgc
ggcctgtatccgccgggctcgacgatcaagccgatggtcgcggtggccggtctggatgcc
ggggtgatcaccccgcagacccgagtgttcgaccccggctactaccagttgcccggccac
agtcacaagtaccgcaactggaaccgcctgggcgatggctcggtgaacatggagttcgcc
atcatgcgctccaacgacacctacttttacgacctcgcgcgcaagatgggcgtggaccgc
ctgcacgactacatgacgcgcttcggcctgggtcagaaggtggcgctagacatgttcgaa
gaagcccctggcctgatgccgtcgcgcgagtggaagcgtgcgcgctaccgccaggcctgg
tatccgggcgagacgctgatccttggcatcggccagggctacatgcagaccactccgctg
cagttggcccaggccaccgcgctgatggccacccgcggcaagtggattcgcccacacctg
ctgaagaccgccgaggggcagacgccgcagcagctgatggccgatggcgccatggatggg
gtgatgacgccgccggacatcgtgctgcgcgacgacaagttctgggactacggccgcctg
ggcatggaggccgtgatgcacgggccgcgcggcactgccgccaaggtcggcgccacctcg
gtgtaccgtatcgccggcaagagcggcacggcccaggtggtggcgatcaagcagggcgag
aagtacgaccgcagcaaggttcgcgagcgtcaccgcgaccatgccctgttcgtcgccttc
gcccccgccgaggcgccgaagatcgccgtggcggtgatggtggagaacggcgagtccggc
tccggcgtcgccgcgccggtggtcaagcaggtgatggacgcctggctgctcggtcccgac
ggccagctcaagcccgagtatcgccccccggtgccggtaaccgaagaggctagtgtgcag
cgatga

DBGET integrated database retrieval system