KEGG   Pseudomonas alcaligenes: A0T30_08290Help
Entry
A0T30_08290       CDS       T04318                                 

Definition
(GenBank) protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
palc  Pseudomonas alcaligenes
Pathway
palc02025  Biofilm formation - Pseudomonas aeruginosa
palc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:palc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A0T30_08290
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    A0T30_08290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:palc01001]
    A0T30_08290
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:palc02044]
    A0T30_08290
Enzymes [BR:palc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A0T30_08290
Protein kinases [BR:palc01001]
 Serine/threonine kinases: Other
  Bacterial family
   A0T30_08290
Secretion system [BR:palc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   A0T30_08290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_2 TPR_14 TPR_19 TPR_1 Pkinase_fungal APH DUF3357 Kdo Kinase-like
Motif
Other DBs
NCBI-ProteinID: AMR66362
UniProt: A0A142IPY0
LinkDB All DBs
Position
1834832..1836529
Genome map
AA seq 565 aa AA seqDB search
MSTTLLEIPGYRVHGALGKGGMAEVFLATQESLSRKVAIKVLRSAEDETFSQRFIKEAHI
VASLNHPSIITIYDIDRLADGRYYLAMEFLPGGDLARHKGELFAPERALQIVRQVASGLA
VVHDKGLVHRDVKPANVLFRGDGTAVLTDFGVAKDLDIDSELTQFGVAVGSPAYSSPEQA
QCQPLDARSDIYSLGVILLEMLTGSNPFRGGNYTQTVVNHVQMEPPLPDSLGAFRGVLAR
MLAKKPDERFADCRALLAALDEVELSDLEETQIRPALALPEPAAPVAAPVPRQRRSAMPL
LVVLSVLVLIGTLTSAGLYIQQQRQIEALLVQAEQRFAAGQLIEPEQDSAEHYFNQILAI
DDDSSEALAGLQRIREARIKVFTDLAEQRLADGLLTEPSEDNADFYYRQALAIDPQHAGA
LAGLSRVLQARIARYLALAEQSIADKRLLLPEEDSAVYYYRQILGWSPDNAEALAGLNRV
ALLYRDLANAAYRRSDFPAALAMIERGLEAEPQNPELLQMQGEHQQLLADARAANARAAA
DRAAREERERSSNPIKRAWNNIFGQ
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccactctgcttgaaatccccggctaccgggtccacggcgcgctgggcaagggc
ggcatggccgaggttttcctggccacccaggagtcattgagccgcaaggtggcgatcaag
gtgctgcgcagcgccgaagacgagaccttcagccagcgcttcatcaaggaagcgcacatc
gttgcctcgctcaatcacccgtcgatcatcaccatctatgacatcgaccgcctggccgac
ggccgctactacctggccatggagttcctccctggcggcgatctggcgcggcacaagggc
gagctgttcgcccccgagcgcgccctgcagatcgtgcgccaggtcgccagcggcctggcc
gtggtgcatgacaagggcctggtgcatcgcgacgtgaagccggccaatgtgctgttccgt
ggcgatggcaccgctgtgctcacggattttggcgtggccaaggacctggacatcgacagc
gagctgacccagttcggcgtggccgtcggcagtccggcctacagcagccccgagcaggcc
cagtgccagccgctggatgcgcgcagcgacatctacagcttgggcgtgatcctgctggag
atgctcaccggcagcaatcctttccgcggcggcaactacacccagaccgtggtcaaccat
gtgcagatggagccgccgctgccggacagcctcggcgccttccgcggcgtgctggcgcgc
atgctggcgaagaagccggacgagcgtttcgccgactgccgtgcgctgctcgccgcgctg
gacgaggtggaactgagcgatctggaagagacccagatccgtccggcgctggcgctgccc
gaacctgccgcgccggttgcagcgcccgtaccgcgccagcgccgctcggccatgccgctg
ctggtggtgctcagcgtgctggtgctgatcggcaccctgacctccgccggcttgtacatc
cagcagcagcggcagatcgaggcgctgctggtccaggccgagcagcgcttcgccgccggc
cagttgatcgagccggagcaggacagcgccgagcattacttcaaccagatcctcgccatc
gatgacgacagcagcgaggcgctggccggcctgcagcgcattcgcgaggcgcgcatcaag
gtctttaccgacctggccgagcagcgcctggccgacggtctgctgaccgagccgagcgaa
gacaacgccgacttctactaccgccaggccctggccatagacccgcagcacgccggtgcg
ctcgccgggctgagccgtgtactgcaggcgcgcattgcccgctacctggcgctggccgag
cagagcatcgccgacaagcgcctgctgctgcccgaggaggacagcgcggtgtactactac
cggcagatcctaggctggtcgccggataacgccgaggccctggccgggctcaatcgcgtg
gccctgctgtaccgtgacctggccaatgccgcctatcggcgcagcgacttcccagccgcc
ctggccatgatcgagcgcggcctggaggccgagccgcagaacccggaactgctgcagatg
cagggcgaacaccagcaattgctggccgacgcccgtgccgccaatgcccgcgccgccgcc
gatcgcgccgcgcgcgaggagcgcgaacgcagcagcaatccgatcaaacgtgcctggaac
aacatcttcggtcagtag

DBGET integrated database retrieval system