KEGG   Pseudomonas alcaligenes: A0T30_15765Help
Entry
A0T30_15765       CDS       T04318                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
palc  Pseudomonas alcaligenes
Brite
KEGG Orthology (KO) [BR:palc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A0T30_15765
Enzymes [BR:palc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     A0T30_15765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Plant_NMP1 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AMR67753
UniProt: A0A142ITX1
LinkDB All DBs
Position
3449301..3450005
Genome map
AA seq 234 aa AA seqDB search
MSDLSAFAITRKWPAQHPERLQLYSLPTPNGVKVSIMLEETGLAYEPHLVSFDNNDQFSP
EFLSLNPNNKIPAILDPNGPGGEPLALFESGAILIYLAEKTGQLLAQDPARRYQTLQWLM
FQMGGIGPMFGQLGFFHKFAGRDYADKRPRDRYVAESARLLGVLDQHLQDRDWMMGQDYS
IADIALFPWVRNLVGFYEAGELVQFERFANVRRVLDAFLARPAVQRGLSIPARG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctgtccgccttcgccatcacccgcaaatggcctgcccagcaccccgagcgc
ctgcagctgtactcgctgcccacgcccaacggggtcaaggtgtcgatcatgctggaagag
accggcctggcctacgagccgcacctggtcagcttcgacaacaacgaccagttcagcccc
gagttcctctcgctcaacccgaacaacaagatccccgccatcctcgaccccaacgggccc
ggcggcgaaccgctggcgctgttcgagtccggcgccatcctcatctacctggccgagaaa
accggccagctgctggcccaggacccggcccggcgctaccagaccctgcagtggctgatg
ttccagatgggcggtatcggcccgatgttcggccagctcggcttcttccacaaattcgcc
ggacgcgactacgccgacaagcgcccgcgcgaccgctacgtagccgaatccgcccgcctg
ctcggtgtgctcgaccagcatctgcaggaccgtgactggatgatgggccaggactacagc
attgccgatatcgccctgtttccctgggtgcgcaacctggtcggcttctacgaggccggc
gaactggtgcagttcgagcgctttgccaatgtgcgccgcgtactcgacgccttcctcgcg
cgcccggcggtgcagcgtgggctgagtattccggcgcgcggctga

DBGET integrated database retrieval system