KEGG   Pseudomonas alcaligenes: A0T30_16670Help
Entry
A0T30_16670       CDS       T04318                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
palc  Pseudomonas alcaligenes
Brite
KEGG Orthology (KO) [BR:palc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A0T30_16670
Enzymes [BR:palc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A0T30_16670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin AlaDh_PNT_C DAO FAD_binding_3 K_oxygenase Thi4 FMO-like NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AMR67919
UniProt: A0A142IUD7
LinkDB All DBs
Position
3625142..3626698
Genome map
AA seq 518 aa AA seqDB search
MLDANLQTQLKAYLEKVTQPFEIVASLDDGEKSQELLGLLKDIVGLTDKITLKTDGNDAR
RPSFSLNRPGADIGVTFAGIPMGHEFTSLVLALLQVGGHPSKLDAETIEQIKSIEGRFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRNVSIDGALFQEEVERRQIMAVPSIYLNGEVF
ASGRMEVKEILAKIDTQAGNRDAEKMNAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLARALEEHVRQYEVDIMNLQRASALVPASAEGG
LHEVKFDNGASLKAKTVILSTGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFADTLRADAVLQTKLNSLPNVTVIKSALTTEVIGDG
QKVTGLTYKDRTTDALHTVELEGIFVQIGLLPNSDWLKGTVELNRFGEIIVDAKGATNIP
GVFAAGDVTTVPYKQIVIAVGEGSKASLSAFDHLIRHS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctgcaaacccagttgaaggcctacctcgagaaggtcacccagccg
ttcgagatcgtcgccagcctcgatgacggcgagaagtctcaggagctgctcggactgctc
aaagacatcgtcggcctgaccgacaagatcaccctcaagaccgatggcaacgacgcacgt
cgtccgtcgttctcgctcaaccgtccgggtgcggatatcggcgttaccttcgccggcatc
cccatgggccacgaattcacctcgctggtactggccctgctgcaggtcggcggccacccg
tccaagctggacgcggaaaccatcgagcagatcaagagcatcgaaggccgtttcgaattc
gaaacctacttctcgctgagctgccagaactgcccggacgtggtccaggcactgaacctg
atggccgtgctcaaccccaacatccgcaacgtctccatcgacggtgcgctgttccaggaa
gaagtcgagcgtcgccagatcatggccgtgccgagcatctacctgaacggtgaagtgttc
gcctcgggtcgcatggaggtgaaggaaatcctcgccaagatcgacacccaggccggcaac
cgcgatgccgagaagatgaacgccaaggacgccttcgacgtgctggtcgtcggtggtggc
ccggccggcgccgcagcggccatctacgccgcgcgtaaaggcatccgcaccggcgtggca
gccgagcgtttcggcggccaagtgctggacaccatggccatcgagaacttcatctcggtg
caggaaaccgaagggccgaaactggcccgcgccctggaagagcacgtgcgtcagtacgaa
gtcgacatcatgaacctgcagcgcgcttccgccctggttccggccagtgccgaaggcggc
ctgcacgaagtgaagttcgacaatggcgccagcctcaaggccaagaccgtgatcctctcc
accggtgcccgctggcgtgaaatgggcgtacccggcgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcactgcgacggtccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggtgtcgaggcggcgattgacctcgccggcatcgtcgcccacgtc
accctgctggaattcgccgacaccctgcgtgccgatgccgtgctgcagaccaagctgaac
agcctgccgaacgtcaccgtgatcaagagcgcgctgaccaccgaagtgatcggcgacggc
cagaaagtcaccggcctgacctacaaggaccgcaccaccgacgcgctgcacaccgtcgaa
ctggagggcatcttcgtgcagatcggcctgctgcccaacagcgactggctgaaaggcacc
gtggaactcaaccgcttcggcgagatcatcgtcgacgccaagggcgctaccaacatcccc
ggcgtgttcgctgccggtgacgtgaccaccgtgccgtacaagcagatcgtcatcgccgtc
ggcgaaggctccaaggcctcgctgagcgccttcgaccacctgatccgccacagctga

DBGET integrated database retrieval system