KEGG   Pteropus alecto (black flying fox): 102877853
Entry
102877853         CDS       T02993                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04020  Calcium signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04114  Oocyte meiosis
pale04140  Autophagy - animal
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04340  Hedgehog signaling pathway
pale04371  Apelin signaling pathway
pale04530  Tight junction
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04727  GABAergic synapse
pale04728  Dopaminergic synapse
pale04740  Olfactory transduction
pale04742  Taste transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04910  Insulin signaling pathway
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04962  Vasopressin-regulated water reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04976  Bile secretion
pale05012  Parkinson disease
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05032  Morphine addiction
pale05034  Alcoholism
pale05146  Amoebiasis
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102877853 (PRKACB)
   04014 Ras signaling pathway
    102877853 (PRKACB)
   04310 Wnt signaling pathway
    102877853 (PRKACB)
   04340 Hedgehog signaling pathway
    102877853 (PRKACB)
   04371 Apelin signaling pathway
    102877853 (PRKACB)
   04020 Calcium signaling pathway
    102877853 (PRKACB)
   04024 cAMP signaling pathway
    102877853 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102877853 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102877853 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102877853 (PRKACB)
   04540 Gap junction
    102877853 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102877853 (PRKACB)
   04062 Chemokine signaling pathway
    102877853 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    102877853 (PRKACB)
   04910 Insulin signaling pathway
    102877853 (PRKACB)
   04922 Glucagon signaling pathway
    102877853 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    102877853 (PRKACB)
   04912 GnRH signaling pathway
    102877853 (PRKACB)
   04913 Ovarian steroidogenesis
    102877853 (PRKACB)
   04915 Estrogen signaling pathway
    102877853 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    102877853 (PRKACB)
   04921 Oxytocin signaling pathway
    102877853 (PRKACB)
   04926 Relaxin signaling pathway
    102877853 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    102877853 (PRKACB)
   04918 Thyroid hormone synthesis
    102877853 (PRKACB)
   04919 Thyroid hormone signaling pathway
    102877853 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    102877853 (PRKACB)
   04916 Melanogenesis
    102877853 (PRKACB)
   04924 Renin secretion
    102877853 (PRKACB)
   04925 Aldosterone synthesis and secretion
    102877853 (PRKACB)
   04927 Cortisol synthesis and secretion
    102877853 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102877853 (PRKACB)
   04270 Vascular smooth muscle contraction
    102877853 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    102877853 (PRKACB)
   04971 Gastric acid secretion
    102877853 (PRKACB)
   04976 Bile secretion
    102877853 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102877853 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102877853 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102877853 (PRKACB)
   04727 GABAergic synapse
    102877853 (PRKACB)
   04725 Cholinergic synapse
    102877853 (PRKACB)
   04728 Dopaminergic synapse
    102877853 (PRKACB)
   04726 Serotonergic synapse
    102877853 (PRKACB)
   04720 Long-term potentiation
    102877853 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    102877853 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    102877853 (PRKACB)
   04742 Taste transduction
    102877853 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    102877853 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    102877853 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    102877853 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102877853 (PRKACB)
   04714 Thermogenesis
    102877853 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102877853 (PRKACB)
   05205 Proteoglycans in cancer
    102877853 (PRKACB)
   05203 Viral carcinogenesis
    102877853 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102877853 (PRKACB)
   05020 Prion disease
    102877853 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    102877853 (PRKACB)
   05031 Amphetamine addiction
    102877853 (PRKACB)
   05032 Morphine addiction
    102877853 (PRKACB)
   05034 Alcoholism
    102877853 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102877853 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102877853 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102877853 (PRKACB)
   05163 Human cytomegalovirus infection
    102877853 (PRKACB)
   05165 Human papillomavirus infection
    102877853 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102877853 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102877853 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102877853 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pale03019]
    102877853 (PRKACB)
   03036 Chromosome and associated proteins [BR:pale03036]
    102877853 (PRKACB)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102877853 (PRKACB)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  PKA family
   102877853 (PRKACB)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102877853 (PRKACB)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102877853 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 102877853
NCBI-ProteinID: XP_006919416
LinkDB
Position
Unknown
AA seq 397 aa
MAAYRELSCNQYTGTTALQKLEGFASRLFHRHSKGTTHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFSEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttatagagaactatcctgtaaccagtatacaggtacaactgctcttcagaag
ttggaaggttttgctagccgattatttcatagacactctaaaggtactacacatgatcag
aaaacagctctggaaaatgacagccttcatttctctgaacatactgcgttatgggacaga
tcaatgaaagagtttctagctaaagccaaagaagactttttaaaaaagtgggaaaatcct
gctcagaataatgctggcttggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaaacaaatagaacatactttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggagtattcttttaaggataat
tctaatttatatatggttatggaatatgtccctgggggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctgaca
tttgagtaccttcattcactagacctcatctacagagatctaaaacctgaaaatctccta
attgaccaccaaggttatatccaggtcacagactttgggtttgccaaaagagttaaaggc
agaacttggacattgtgtggtactccagaatatttggctccagaaataatcctcagcaag
ggctacaataaggcagtggattggtgggcattaggagtattaatctatgaaatggcagct
ggctaccccccattctttgcagatcaaccaattcagatttatgaaaagattgtttctgga
aaggttcgatttccatcacacttcagttcggatctcaaggaccttctaaggaacctgctg
caggtggatttgacaaagcggtttggaaatctaaagaatggtgtcagcgatataaaaact
cacaagtggtttgctacaacagattggattgctatttaccagaggaaggttgaagctcca
ttcataccaaagtttagaggctctggggataccagcaactttgatgactatgaagaggaa
gatatccgtgtctctataacagaaaaatgtgcaaaagaatttagtgaattttaa

KEGG   Pteropus alecto (black flying fox): 102886679
Entry
102886679         CDS       T02993                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04020  Calcium signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04114  Oocyte meiosis
pale04140  Autophagy - animal
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04261  Adrenergic signaling in cardiomyocytes
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04340  Hedgehog signaling pathway
pale04371  Apelin signaling pathway
pale04530  Tight junction
pale04540  Gap junction
pale04611  Platelet activation
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04720  Long-term potentiation
pale04723  Retrograde endocannabinoid signaling
pale04724  Glutamatergic synapse
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04727  GABAergic synapse
pale04728  Dopaminergic synapse
pale04740  Olfactory transduction
pale04742  Taste transduction
pale04750  Inflammatory mediator regulation of TRP channels
pale04910  Insulin signaling pathway
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04913  Ovarian steroidogenesis
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04922  Glucagon signaling pathway
pale04923  Regulation of lipolysis in adipocytes
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale04962  Vasopressin-regulated water reabsorption
pale04970  Salivary secretion
pale04971  Gastric acid secretion
pale04976  Bile secretion
pale05012  Parkinson disease
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05032  Morphine addiction
pale05034  Alcoholism
pale05146  Amoebiasis
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102886679 (PRKACA)
   04014 Ras signaling pathway
    102886679 (PRKACA)
   04310 Wnt signaling pathway
    102886679 (PRKACA)
   04340 Hedgehog signaling pathway
    102886679 (PRKACA)
   04371 Apelin signaling pathway
    102886679 (PRKACA)
   04020 Calcium signaling pathway
    102886679 (PRKACA)
   04024 cAMP signaling pathway
    102886679 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102886679 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102886679 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102886679 (PRKACA)
   04540 Gap junction
    102886679 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102886679 (PRKACA)
   04062 Chemokine signaling pathway
    102886679 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    102886679 (PRKACA)
   04910 Insulin signaling pathway
    102886679 (PRKACA)
   04922 Glucagon signaling pathway
    102886679 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    102886679 (PRKACA)
   04912 GnRH signaling pathway
    102886679 (PRKACA)
   04913 Ovarian steroidogenesis
    102886679 (PRKACA)
   04915 Estrogen signaling pathway
    102886679 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    102886679 (PRKACA)
   04921 Oxytocin signaling pathway
    102886679 (PRKACA)
   04926 Relaxin signaling pathway
    102886679 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    102886679 (PRKACA)
   04918 Thyroid hormone synthesis
    102886679 (PRKACA)
   04919 Thyroid hormone signaling pathway
    102886679 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    102886679 (PRKACA)
   04916 Melanogenesis
    102886679 (PRKACA)
   04924 Renin secretion
    102886679 (PRKACA)
   04925 Aldosterone synthesis and secretion
    102886679 (PRKACA)
   04927 Cortisol synthesis and secretion
    102886679 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102886679 (PRKACA)
   04270 Vascular smooth muscle contraction
    102886679 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    102886679 (PRKACA)
   04971 Gastric acid secretion
    102886679 (PRKACA)
   04976 Bile secretion
    102886679 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102886679 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102886679 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102886679 (PRKACA)
   04727 GABAergic synapse
    102886679 (PRKACA)
   04725 Cholinergic synapse
    102886679 (PRKACA)
   04728 Dopaminergic synapse
    102886679 (PRKACA)
   04726 Serotonergic synapse
    102886679 (PRKACA)
   04720 Long-term potentiation
    102886679 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    102886679 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    102886679 (PRKACA)
   04742 Taste transduction
    102886679 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    102886679 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    102886679 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    102886679 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102886679 (PRKACA)
   04714 Thermogenesis
    102886679 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102886679 (PRKACA)
   05205 Proteoglycans in cancer
    102886679 (PRKACA)
   05203 Viral carcinogenesis
    102886679 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102886679 (PRKACA)
   05020 Prion disease
    102886679 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    102886679 (PRKACA)
   05031 Amphetamine addiction
    102886679 (PRKACA)
   05032 Morphine addiction
    102886679 (PRKACA)
   05034 Alcoholism
    102886679 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102886679 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102886679 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102886679 (PRKACA)
   05163 Human cytomegalovirus infection
    102886679 (PRKACA)
   05165 Human papillomavirus infection
    102886679 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102886679 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102886679 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102886679 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pale03019]
    102886679 (PRKACA)
   03036 Chromosome and associated proteins [BR:pale03036]
    102886679 (PRKACA)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102886679 (PRKACA)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  PKA family
   102886679 (PRKACA)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102886679 (PRKACA)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102886679 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 102886679
NCBI-ProteinID: XP_006918822
LinkDB
Position
Unknown
AA seq 343 aa
MASNPNDVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGS
HFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEFSFKDNSNLYMIMEYVPGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ
RKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcttccaaccccaacgacgtgaaagagttcttagccaaagccaaagaagattttctt
aaaaaatgggaaaatcctgctcagaatacagcccatttggatcagtttgaacgaatcaag
accctcggcacaggctccttcgggcgggtgatgctagtaaaacacaaggagaccgggagc
cacttcgccatgaagatcctggacaaacagaaggtggtaaagctgaaacagatcgagcac
accctgaacgagaagcgcatcctgcaggcagtcaactttccgttcctcgttagactcgag
ttctccttcaaggacaactcaaatttatacatgatcatggagtatgtgcctggcggggaa
atgttctcacacctgcggcggatcggaaggttcagcgagccccatgcccgcttctacgcc
gcccagatcgtcctgaccttcgagtacctgcactcccttgatctcatctaccgggacctg
aagccggagaaccttctcatcgaccagcagggctacattcaggttacagactttggtttt
gccaagcgtgtgaaaggccgcacctggaccttgtgtgggacccctgagtacctggcccct
gagatcatactgagcaaaggctacaacaaggctgtggactggtgggcactgggggttctc
atctatgagatggccgccggctacccacccttcttcgctgaccagcccatccagatctat
gagaagattgtctctgggaaggtgcggttcccgtctcacttcagctctgacctgaaggat
ctgctgcggaacctactgcaggtggacctcaccaagcgctttgggaacctcaagaatggg
gtcaatgacatcaagaaccacaagtggtttgccacaactgactggatcgccatctaccag
aggaaggtggaagctcccttcataccaaagtttaaaggccctggggacacgagtaacttt
gacgactatgaggaggaagagattcgagtctccatcaatgagaagtgtggcaaggagttt
tctgagttttag

DBGET integrated database retrieval system