KEGG   Pteropus alecto (black flying fox): 102877877
Entry
102877877         CDS       T02993                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X2
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04068  FoxO signaling pathway
pale04270  Vascular smooth muscle contraction
pale04650  Natural killer cell mediated cytotoxicity
pale04720  Long-term potentiation
pale04726  Serotonergic synapse
pale04730  Long-term depression
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04928  Parathyroid hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05034  Alcoholism
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102877877 (ARAF)
   04012 ErbB signaling pathway
    102877877 (ARAF)
   04068 FoxO signaling pathway
    102877877 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102877877 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102877877 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102877877 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    102877877 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102877877 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102877877 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102877877 (ARAF)
   04720 Long-term potentiation
    102877877 (ARAF)
   04730 Long-term depression
    102877877 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102877877 (ARAF)
   05205 Proteoglycans in cancer
    102877877 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102877877 (ARAF)
   05212 Pancreatic cancer
    102877877 (ARAF)
   05225 Hepatocellular carcinoma
    102877877 (ARAF)
   05226 Gastric cancer
    102877877 (ARAF)
   05214 Glioma
    102877877 (ARAF)
   05221 Acute myeloid leukemia
    102877877 (ARAF)
   05220 Chronic myeloid leukemia
    102877877 (ARAF)
   05218 Melanoma
    102877877 (ARAF)
   05211 Renal cell carcinoma
    102877877 (ARAF)
   05219 Bladder cancer
    102877877 (ARAF)
   05215 Prostate cancer
    102877877 (ARAF)
   05213 Endometrial cancer
    102877877 (ARAF)
   05224 Breast cancer
    102877877 (ARAF)
   05223 Non-small cell lung cancer
    102877877 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102877877 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    102877877 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    102877877 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102877877 (ARAF)
   05160 Hepatitis C
    102877877 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102877877 (ARAF)
   01522 Endocrine resistance
    102877877 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102877877 (ARAF)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102877877 (ARAF)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102877877 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 102877877
NCBI-ProteinID: XP_006906970
LinkDB
Position
Unknown
AA seq 636 aa
MEPPRAPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSVQDLSGGSRQHEAPSNRPLNEPL
TPQGPSLSPGSSCTQHRDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSSLIQLT
TQSFSTDGEPPLPAPSAHPSTPLVSTHFSTITAAGNRGGGDGAPRGSPSPATVSSGRKSP
HSKSPSEQRERKPLADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWH
GDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSL
YHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGL
ATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYS
HIGSRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLFPQILATIELL
QRSLPKIERSASEPSLHRTQADELPACLLSAARLVP
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggagccaccacgggcaccccctgccaatggggctgagccgtcccgggcagtgggcact
gtaaaagtgtacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtctatgactctttagacaaggccctcaaggtacggggtctcaatcaggattgctgtgtg
gtctaccggctcatcaaaggacgaaagacggtcactgcctgggacacagccattgctccc
ctggatggcgaggagctcattgtggaggtccttgaagatgtcccactgaccatgcacaat
tttgtacggaagacgttcttcagcctggcattctgtgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgatatgagtaccaaccgccgacagttctaccacagtgtccaggat
ttgtccggaggctccagacagcacgaggctccctcaaaccgccccctgaatgagccgcta
acccctcagggtcccagcctttcccctggcagctcctgcacccagcaccgcgaccccgag
cacttccccttccctgccccagccaacgcccccctccagcgcatccgctccacatccacc
cccaatgtccatatggtcagcaccacggcccccatggactccagcctcatccagctcact
acccagagtttcagcactgatggtgagcccccactgcctgcaccctcagcacacccctcc
actccacttgtctccactcacttctccacaatcacagctgctggtaatagaggtggtgga
gatggagccccccgggggagccccagcccagccaccgtgtcctcggggaggaagtcccca
cattccaagtccccatcagaacagcgggagcggaagcctttggccgatgacaagaagaaa
gtgaagaatctagggtaccgggattcgggctattactgggaggtgccacccagtgaggtg
cagctgctgaagaggatcgggacgggctcatttggcactgtgtttcgcgggcggtggcat
ggagatgtggctgtgaaggtgctcaaggtggcccaacccacagctgagcaggcccaggcc
ttcaagaatgagatgcaggtgctcaggaagacacgtcatgtcaacatcttgctgttcatg
ggcttcatgacccggccggggttcgccatcatcacacagtggtgtgagggctccagcctc
taccaccacctccatgtggctgacacacgttttgacatggtccagctcattgatgtggcc
cggcagactgcccagggcatggactacctccatgccaagaacatcatccaccgagatctc
aagtctaacaacatctttttacatgagggacttacggtgaagatcggtgactttggcctg
gccacagtgaagacgcggtggagtggagctcagcctttggaacagccctcgggctctgtg
ctatggatggcggctgaggtgattcgtatgcaggacccgaacccctacagcttccagtcg
gatgtctacgcctatggggttgtgctctatgagctcatgaccggctccctgccttacagc
cacattggcagccgtgaccagattatctttatggtgggccgtggctatctgtctcctgac
ctcagcaaaatctctagtaactgccccaaagccatgcgacgcctgctgtccgactgcctg
aagttccagcgggaggagcggcctctcttcccccagatcctggccacgattgagctgctg
cagcggtcactccccaagattgagcggagtgcctcagaaccttctttgcaccgtacccag
gctgatgagttgcccgcctgcctactcagcgcagcccgccttgtgccttag

KEGG   Pteropus alecto (black flying fox): 102878393
Entry
102878393         CDS       T02993                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04015  Rap1 signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04068  FoxO signaling pathway
pale04150  mTOR signaling pathway
pale04270  Vascular smooth muscle contraction
pale04510  Focal adhesion
pale04650  Natural killer cell mediated cytotoxicity
pale04720  Long-term potentiation
pale04722  Neurotrophin signaling pathway
pale04726  Serotonergic synapse
pale04730  Long-term depression
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale05010  Alzheimer disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05034  Alcoholism
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05216  Thyroid cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102878393 (BRAF)
   04012 ErbB signaling pathway
    102878393 (BRAF)
   04015 Rap1 signaling pathway
    102878393 (BRAF)
   04068 FoxO signaling pathway
    102878393 (BRAF)
   04024 cAMP signaling pathway
    102878393 (BRAF)
   04150 mTOR signaling pathway
    102878393 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102878393 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102878393 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102878393 (BRAF)
   04062 Chemokine signaling pathway
    102878393 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102878393 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    102878393 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102878393 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102878393 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102878393 (BRAF)
   04720 Long-term potentiation
    102878393 (BRAF)
   04730 Long-term depression
    102878393 (BRAF)
   04722 Neurotrophin signaling pathway
    102878393 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878393 (BRAF)
   05205 Proteoglycans in cancer
    102878393 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102878393 (BRAF)
   05212 Pancreatic cancer
    102878393 (BRAF)
   05225 Hepatocellular carcinoma
    102878393 (BRAF)
   05226 Gastric cancer
    102878393 (BRAF)
   05214 Glioma
    102878393 (BRAF)
   05216 Thyroid cancer
    102878393 (BRAF)
   05221 Acute myeloid leukemia
    102878393 (BRAF)
   05220 Chronic myeloid leukemia
    102878393 (BRAF)
   05218 Melanoma
    102878393 (BRAF)
   05211 Renal cell carcinoma
    102878393 (BRAF)
   05219 Bladder cancer
    102878393 (BRAF)
   05215 Prostate cancer
    102878393 (BRAF)
   05213 Endometrial cancer
    102878393 (BRAF)
   05224 Breast cancer
    102878393 (BRAF)
   05223 Non-small cell lung cancer
    102878393 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102878393 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    102878393 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    102878393 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102878393 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102878393 (BRAF)
   05160 Hepatitis C
    102878393 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102878393 (BRAF)
   01522 Endocrine resistance
    102878393 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102878393 (BRAF)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102878393 (BRAF)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102878393 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo DUF1593
Other DBs
NCBI-GeneID: 102878393
NCBI-ProteinID: XP_015443846
LinkDB
Position
Unknown
AA seq 723 aa
MIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVS
SSASTDTVTSSSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPAR
CGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVS
KFFEHHPIPQEEASLAETTLTSGSSPSAPPSDSIGPQILTSPSPSKSIPIPQPFRPADED
HRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTN
VKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVY
KGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWC
EGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKI
GDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTG
QLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFLQILA
SIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYDISGCQTPGEFA
AFK
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgataaagttgacacaggaacatatagaggccctattggacaaatttggtggggagcat
aatccaccatcaatatatctggaggcctatgaagaatacaccagcaagctagatgccctc
caacaaagagaacaacagttattggaatccctggggaatggaactgatttttctgtttct
agctctgcatcaacggacaccgttacatcttcttcctcttctagcctttcagtgctacct
tcatctctttcagtttttcaaaatcccacagatgtgtcacggagcaaccctaaatcacca
caaaaacctattgttagagtcttcctgcccaacaaacagaggacagtggtacctgcaagg
tgtggagttacagtccgggacagtctaaagaaagcactgatgatgagaggtctaatccca
gagtgctgtgctgtttacagaattcaagatggagagaagaagccaattggctgggacacc
gatatttcctggcttactggagaggagttacatgtagaagtgctggaaaatgtcccactt
acaacacacaactttgtacggaaaacttttttcaccttagcattttgtgacttttgtcga
aagctgcttttccagggtttccgctgtcaaacatgtggttataaatttcaccagcgttgt
agtacagaggttcctctgatgtgtgttaattatgaccaacttgatttgctgtttgtctcc
aagttctttgaacaccacccaataccacaggaggaggcctccctagcagagaccaccctt
acgtctggatcatccccttccgcacccccttccgattctattgggccccaaattctcacc
agtccgtctccttcaaaatccattccaattccacagcctttccgaccagcagatgaagat
catcgaaatcagtttggacaacgagaccggtcttcgtcagctccaaatgtgcatataaac
acaatagagcctgtcaatattgatgacttgattagagaccaagggtttcgtagtgatgga
ggatcaaccacaggtttgtctgccaccccccctgcctcattacctggctcactcactaat
gtgaaagcattgcagaaatctccaggacctcagcgggaacggaaatcatcttcttcctca
gaagacaggaatcgaatgaaaacacttggtagacgggattcaagtgatgattgggagatt
cctgatgggcagatcacagtgggacaaagaattggatctgggtcatttgggacagtctac
aaaggaaagtggcatggtgatgtggcagtgaagatgttgaatgtgacagcacccacacct
cagcagttacaggccttcaaaaatgaagtaggagtactcaggaaaacgcgacatgtgaat
atcctactcttcatgggctattcaacaaagccacagctggctattgttacccagtggtgt
gagggctccagcttatatcaccacctccacatcattgagaccaaatttgagatgatcaaa
cttatagatattgcacggcagactgcacagggcatggattacttacacgccaagtcaatc
atccacagagacctcaagagtaataatatatttcttcatgaagacctcacagtaaaaata
ggtgactttggtctagccacagtgaaatctcgatggagtgggtcccatcagtttgaacag
ttgtctggatccattttgtggatggcaccagaagtaatcagaatgcaagataaaaaccca
tatagttttcagtcagatgtatatgcatttgggattgttctgtatgaattgatgactgga
cagttaccttattcaaacatcaacaacagggaccagataatttttatggtgggacgagga
tatctgtctccagatctcagtaaggtacgaagtaactgtccaaaagccatgaagagatta
atggcagagtgcctaaaaaagaaaagagatgaaagaccactctttctccaaattctcgcc
tctattgagctgctggcccgctcattgccaaaaattcaccgcagtgcatcagaaccctcc
ttgaatcgggccggcttccaaacagaggattttagtctatatgcttgtgcttctccaaaa
acacccatccaggcagggggatatgatatctctggttgccaaacaccaggagaatttgca
gccttcaagtag

KEGG   Pteropus alecto (black flying fox): 102893439
Entry
102893439         CDS       T02993                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04218  Cellular senescence
pale04270  Vascular smooth muscle contraction
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04371  Apelin signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04666  Fc gamma R-mediated phagocytosis
pale04720  Long-term potentiation
pale04722  Neurotrophin signaling pathway
pale04726  Serotonergic synapse
pale04730  Long-term depression
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04912  GnRH signaling pathway
pale04914  Progesterone-mediated oocyte maturation
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04929  GnRH secretion
pale04935  Growth hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05034  Alcoholism
pale05132  Salmonella infection
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102893439 (RAF1)
   04012 ErbB signaling pathway
    102893439 (RAF1)
   04014 Ras signaling pathway
    102893439 (RAF1)
   04015 Rap1 signaling pathway
    102893439 (RAF1)
   04370 VEGF signaling pathway
    102893439 (RAF1)
   04371 Apelin signaling pathway
    102893439 (RAF1)
   04630 JAK-STAT signaling pathway
    102893439 (RAF1)
   04068 FoxO signaling pathway
    102893439 (RAF1)
   04072 Phospholipase D signaling pathway
    102893439 (RAF1)
   04071 Sphingolipid signaling pathway
    102893439 (RAF1)
   04024 cAMP signaling pathway
    102893439 (RAF1)
   04022 cGMP-PKG signaling pathway
    102893439 (RAF1)
   04151 PI3K-Akt signaling pathway
    102893439 (RAF1)
   04150 mTOR signaling pathway
    102893439 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102893439 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    102893439 (RAF1)
   04218 Cellular senescence
    102893439 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102893439 (RAF1)
   04540 Gap junction
    102893439 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102893439 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102893439 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102893439 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    102893439 (RAF1)
   04660 T cell receptor signaling pathway
    102893439 (RAF1)
   04662 B cell receptor signaling pathway
    102893439 (RAF1)
   04664 Fc epsilon RI signaling pathway
    102893439 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    102893439 (RAF1)
   04062 Chemokine signaling pathway
    102893439 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102893439 (RAF1)
   04929 GnRH secretion
    102893439 (RAF1)
   04912 GnRH signaling pathway
    102893439 (RAF1)
   04915 Estrogen signaling pathway
    102893439 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    102893439 (RAF1)
   04917 Prolactin signaling pathway
    102893439 (RAF1)
   04921 Oxytocin signaling pathway
    102893439 (RAF1)
   04926 Relaxin signaling pathway
    102893439 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    102893439 (RAF1)
   04919 Thyroid hormone signaling pathway
    102893439 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    102893439 (RAF1)
   04916 Melanogenesis
    102893439 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102893439 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    102893439 (RAF1)
   04720 Long-term potentiation
    102893439 (RAF1)
   04730 Long-term depression
    102893439 (RAF1)
   04722 Neurotrophin signaling pathway
    102893439 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    102893439 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893439 (RAF1)
   05206 MicroRNAs in cancer
    102893439 (RAF1)
   05205 Proteoglycans in cancer
    102893439 (RAF1)
   05230 Central carbon metabolism in cancer
    102893439 (RAF1)
   05231 Choline metabolism in cancer
    102893439 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102893439 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102893439 (RAF1)
   05212 Pancreatic cancer
    102893439 (RAF1)
   05225 Hepatocellular carcinoma
    102893439 (RAF1)
   05226 Gastric cancer
    102893439 (RAF1)
   05214 Glioma
    102893439 (RAF1)
   05221 Acute myeloid leukemia
    102893439 (RAF1)
   05220 Chronic myeloid leukemia
    102893439 (RAF1)
   05218 Melanoma
    102893439 (RAF1)
   05211 Renal cell carcinoma
    102893439 (RAF1)
   05219 Bladder cancer
    102893439 (RAF1)
   05215 Prostate cancer
    102893439 (RAF1)
   05213 Endometrial cancer
    102893439 (RAF1)
   05224 Breast cancer
    102893439 (RAF1)
   05223 Non-small cell lung cancer
    102893439 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102893439 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    102893439 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    102893439 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102893439 (RAF1)
   05152 Tuberculosis
    102893439 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102893439 (RAF1)
   05161 Hepatitis B
    102893439 (RAF1)
   05160 Hepatitis C
    102893439 (RAF1)
   05164 Influenza A
    102893439 (RAF1)
   05163 Human cytomegalovirus infection
    102893439 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102893439 (RAF1)
   05165 Human papillomavirus infection
    102893439 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102893439 (RAF1)
   01522 Endocrine resistance
    102893439 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102893439 (RAF1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102893439 (RAF1)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102893439 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 102893439
NCBI-ProteinID: XP_006917697
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKDTVFDGPSCISPTIVQQFGYQRRASDDGKLMDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDMCQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNVRQLLLFPNSTIGDSGVPALPPLTMRRMRESVSRIPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGSQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagacaca
gtgttcgatggccccagctgcatttcccccacaatagttcagcagtttggctatcagcgt
cgggcgtcagatgatggcaaacttatggactcttctaagacaagcaatactatccgtgtt
ttcttgccaaacaagcaaagaacggtggtcaatgtacgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaggtgaggggcctgcaaccggagtgctgtgcagtgttcaga
cttctccacgaacacaaaggtaaaaaagcacgtttagattggaatactgatgctgcctcg
ttgattggagaagaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagaccttcctgaagcttgccttctgtgacatgtgtcagaagttcctgcta
aatggatttcgatgtcagacttgtggctacaaatttcacgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatgtcagacaactcttattgtttccaaattccacc
attggtgacagtggggtcccagcactgccgcctttgacaatgcgccggatgcgagagtct
gtttcccggattcctgttagttcccagcacagatactccacaccccacgccttcacattc
aacacctccagcccctcctctgaaggttccctctcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggatagcaggatgattgaggatgca
attcgaagtcacagtgaatcagcctcaccttcagccttgtccagcagccccaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccggcacagagagagcgggcacca
ggatccgggagccaggagaaaaataaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctcgactcggattgggtcaggctctttt
ggaactgtttataagggcaagtggcatggagacgttgcagtaaagatcctaaaggttgtc
gaccccacaccagaacagttccaggccttcaggaacgaggtggctgtcctacgcaaaaca
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggcgattgtg
acccagtggtgtgagggcagcagcctctacaaacacctgcatgttcaagagaccaagttc
cagatgttccagttgattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggggattttggtttggcaacagtaaagtcgcgctggagtggttctcag
caggttgaacaacccaccggctctgtcctgtggatggccccagaggtgatccgaatgcaa
gataacaaccccttcagcttccaatcagatgtctactcctatggcattgtgctgtatgag
ctcatgacaggggagctaccttattcccacatcaacaaccgagatcagatcatcttcatg
gtgggccgaggatatgcctctccagaccttagtaagctatacaagaactgccccaaagca
atgaagaggcttgtagctgattgtgtgaagaaagttaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccaacactctctaccgaaaattaaccggagcgct
tctgagccatccctgcatcgggcggctcacaccgaggatatcaatgcctgcacactgacc
acgtcccccagactgcctgtcttctag

DBGET integrated database retrieval system