KEGG   Pteropus alecto (black flying fox): 102877892
Entry
102877892         CDS       T02993                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04140  Autophagy - animal
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04370  VEGF signaling pathway
pale04510  Focal adhesion
pale04722  Neurotrophin signaling pathway
pale04910  Insulin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05010  Alzheimer disease
pale05014  Amyotrophic lateral sclerosis
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05165  Human papillomavirus infection
pale05168  Herpes simplex virus 1 infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05215  Prostate cancer
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05223  Non-small cell lung cancer
pale05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102877892 (BAD)
   04014 Ras signaling pathway
    102877892 (BAD)
   04370 VEGF signaling pathway
    102877892 (BAD)
   04024 cAMP signaling pathway
    102877892 (BAD)
   04022 cGMP-PKG signaling pathway
    102877892 (BAD)
   04151 PI3K-Akt signaling pathway
    102877892 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102877892 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    102877892 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102877892 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102877892 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102877892 (BAD)
   04919 Thyroid hormone signaling pathway
    102877892 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102877892 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102877892 (BAD)
   05203 Viral carcinogenesis
    102877892 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102877892 (BAD)
   05212 Pancreatic cancer
    102877892 (BAD)
   05225 Hepatocellular carcinoma
    102877892 (BAD)
   05221 Acute myeloid leukemia
    102877892 (BAD)
   05220 Chronic myeloid leukemia
    102877892 (BAD)
   05218 Melanoma
    102877892 (BAD)
   05211 Renal cell carcinoma
    102877892 (BAD)
   05215 Prostate cancer
    102877892 (BAD)
   05213 Endometrial cancer
    102877892 (BAD)
   05223 Non-small cell lung cancer
    102877892 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102877892 (BAD)
   05014 Amyotrophic lateral sclerosis
    102877892 (BAD)
   05020 Prion disease
    102877892 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    102877892 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102877892 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102877892 (BAD)
   05161 Hepatitis B
    102877892 (BAD)
   05160 Hepatitis C
    102877892 (BAD)
   05162 Measles
    102877892 (BAD)
   05168 Herpes simplex virus 1 infection
    102877892 (BAD)
   05165 Human papillomavirus infection
    102877892 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102877892 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102877892 (BAD)
   01524 Platinum drug resistance
    102877892 (BAD)
   01522 Endocrine resistance
    102877892 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 102877892
NCBI-ProteinID: XP_006911211
LinkDB
Position
Unknown
AA seq 196 aa
MGGRVRGLGLHSTRAPEGDLGPTWTAQSMFQIPEFEQSEQEDSRPADRGLGPSPTGDQPP
GLSKHRCTASGLLGEAGHQQGQPASSSHNGGAGSVEPRSRHSSYPAGNEEDEEPEEEEPS
PFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQNSSWTHIFQ
SWWDRNLGRGGSAPSQ
NT seq 591 nt   +upstreamnt  +downstreamnt
atgggcgggcgggtccggggcctggggctccacagcaccagggctccggaaggagattta
ggtcctacgtggacagcccagagcatgttccagatcccagagtttgagcagagtgagcag
gaagactccagacctgcagataggggcctgggccccagccccacgggggaccagccccca
ggcctcagcaagcaccggtgtacggcctcaggcctcctgggggaagctggtcatcagcag
gggcagccagccagcagcagccacaatggaggcgccgggtctgtggagcccaggagtcgc
cacagctcgtaccccgccgggaacgaggaggatgaagagccagaggaggaggagcccagc
cccttccggggacgctcacgttcagcgcctcccaacctctgggctgcacagcgctatggc
cgtgagctccggaggatgagcgatgagttcgagggttccttcaagggacttcctcgcccg
aaaagcgcgggcacagcgacgcagatgcggcaaaactccagctggacgcacatcttccag
tcctggtgggatcggaacttgggaagaggaggctccgccccctcccaatga

DBGET integrated database retrieval system