KEGG   Pteropus alecto (black flying fox): 102877910
Entry
102877910         CDS       T02993                                 

Gene name
ESR1
Definition
(RefSeq) estrogen receptor isoform X1
  KO
K08550  estrogen receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04915  Estrogen signaling pathway
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04961  Endocrine and other factor-regulated calcium reabsorption
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102877910 (ESR1)
   04917 Prolactin signaling pathway
    102877910 (ESR1)
   04919 Thyroid hormone signaling pathway
    102877910 (ESR1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102877910 (ESR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102877910 (ESR1)
   05205 Proteoglycans in cancer
    102877910 (ESR1)
  09162 Cancer: specific types
   05224 Breast cancer
    102877910 (ESR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102877910 (ESR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102877910 (ESR1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pale03310]
    102877910 (ESR1)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102877910 (ESR1)
Nuclear receptors [BR:pale03310]
 3. Estrogen like
  3A. Estrogen receptor
   102877910 (ESR1)
SSDB
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Other DBs
NCBI-GeneID: 102877910
NCBI-ProteinID: XP_006915824
LinkDB
Position
Unknown
AA seq 594 aa
MNMTPHTKASGMALLHQIQGNELEPLTHPPLKIPLERPLGEVYVDSSKPAVYDYPEGAAY
DFNAAAVASAPVYGQSGLAYGPGSEAAFSANGLGGFPPLNSVSPSSLVLLHQPPQLSPFL
HPHGQQVPYYLENEPNGYAVREAGPPAFYRPNSDNRRQSGRERLASTGEKGSMAMESAKE
TRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACR
LRKCYEVGMMKGGIRKDRRGGRILKPKRQRDDGENRNEAGSSGDMRAASMWSNPLLIKHP
KKSSPALSLTADQMVSALLEAEPPLIYSEYDPTRPFSEASMMGLLTNLADRELVHMINWA
KRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGM
VEIFDMLLATSSRFRMINLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDK
IIDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLL
EMLDAHRLRGSTNRGDTPMAETHQSHMAATAPTSSHSLQTYYISGEAESFPSTI
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgaacatgactcctcacaccaaagcgtccgggatggctctgctgcaccagatccaaggg
aatgagctggagccgctgacccacccgccactcaagatccccctggagaggcccctgggc
gaggtgtacgtggacagcagcaagcccgctgtctacgactacccagagggcgccgcgtat
gacttcaatgccgcggccgtcgcctccgcgcccgtttacggccagtccggcctcgcctac
ggcccagggtccgaagcggcgttcagcgctaatggcctggggggcttcccgccgctcaac
agtgtgtcgccgagctcgctggtgctgctgcaccagccaccgcagctctcgcccttcctg
cacccccatggccagcaggtgccctattacctggagaacgagccgaacggctatgcggtg
cgcgaggctggccctcccgccttctacaggccaaattcagataatcggcgccagagtggc
agagagagattggccagcaccggtgagaagggaagcatggccatggaatctgccaaggag
actcgctactgtgcagtgtgcaatgactatgcctcaggctaccactatggagtctggtcc
tgcgagggctgtaaggccttcttcaagagaagtattcaaggacataacgactacatgtgt
ccggctaccaaccagtgcacgatcgataaaaacaggaggaagagctgtcaggcctgccgg
ctgcgcaagtgctatgaagtgggcatgatgaaaggtgggatacggaaagaccgaagagga
gggagaatattgaaacccaagcgccaaagagatgatggggagaatagaaatgaagcgggg
tcctctggagacatgagagctgccagcatgtggtcaaaccctctcttgattaagcaccct
aagaagagcagccctgccttatccctgacagcagatcagatggtcagtgccttgttggag
gctgagccccccctaatctattctgagtatgatcctaccagacccttcagtgaggcttcg
atgatgggcttgctaaccaacctcgcagacagggagctggttcacatgatcaactgggca
aagagggtaccaggctttgtggatttgaccctccacgaccaggttcaccttttggaatgt
gcctggctggagatcctgatgatcggtctcgtctggcgctccatggagcacccagggaag
ctcctgtttgctcccaacttgctcctggacaggaaccagggaaaatgtgtggagggcatg
gtggagatctttgacatgttactagctacatcatctcggttccgtatgattaatctccag
ggagaggagtttgtgtgcctcaaatccatcattttgcttaattctggagtatacacattt
ctgtccagcactctgaagtctctggaagagaaggaccatatccaccgagtcctggacaag
atcatagacaccttgatccatctgatggccaaagcaggcctgaccctgcagcagcagcac
cggcgcctggcccaactcctcctcatcctgtcccacatcaggcacatgagtaacaaaggc
atggagcatctgtacaacatgaagtgcaagaacgtggtgcccctctacgacctgctgctg
gagatgctggacgcccaccgcctgcgcggctcgaccaaccgcggggacaccccgatggcg
gagacgcaccagagccacatggccgccacggcccccacctcgtcacattccttgcaaaca
tattacatcagtggggaggcagagagtttccccagcacaatctga

DBGET integrated database retrieval system