KEGG   Pteropus alecto (black flying fox): 102877930
Entry
102877930         CDS       T02993                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04066  HIF-1 signaling pathway
pale04217  Necroptosis
pale04380  Osteoclast differentiation
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05164  Influenza A
pale05168  Herpes simplex virus 1 infection
pale05200  Pathways in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102877930 (IFNGR2)
   04066 HIF-1 signaling pathway
    102877930 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102877930 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102877930 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102877930 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    102877930 (IFNGR2)
   04659 Th17 cell differentiation
    102877930 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102877930 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102877930 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102877930 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102877930 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102877930 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    102877930 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    102877930 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102877930 (IFNGR2)
   05140 Leishmaniasis
    102877930 (IFNGR2)
   05142 Chagas disease
    102877930 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102877930 (IFNGR2)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IFN receptor family
   102877930 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 102877930
NCBI-ProteinID: XP_015452231
LinkDB
Position
Unknown
AA seq 313 aa
MWRRWTFYSRSQLPAPENLKIHLYNAMQVLSWEPVSLSNDTRPVVYQVQFKFSGSDKWSN
VHAPYTEVNCTRITATECSFTQTSLSKGFPLHFNVSLRVRAELAERVSAWVTAPWFQHYR
NVTVGPPENIWVTPGKRSLIVMFSPPFDVDDPSMATFSYYVRYWEKGGIEQVKGPFKSNS
IVLDDLKPLRVYCLQVKAELFWNSFNIRRPGHFSDVTCRETTIDASTKLQQDVLIAIGTF
LVLAMLAVPCLFLVLKYRGLIKYWFESPPSIPLQIEEYLKDPAQPILEALDKDSSPKDDT
WDSVSVISFPEKE
NT seq 942 nt   +upstreamnt  +downstreamnt
atgtggagacgatggacattctactctcgttcccagctgcctgctcctgaaaacctgaag
attcacctgtacaacgccatgcaggttctgagttgggagccggtgtccctgagcaatgac
acaaggcccgtggtctaccaggtgcagttcaaattctctggcagtgacaagtggtccaac
gtccacgcaccgtacacagaggtgaactgtacgaggatcacggccacagagtgtagcttc
acccaaaccagcctctcgaaggggttcccactgcatttcaacgtctccttacgtgtccgg
gcggagctggcggagcgcgtgtctgcctgggtgacggcgccttggttccagcactatcgg
aacgttaccgtcgggcctccagaaaacatttgggtgaccccaggaaaacgctcccttatc
gtcatgttctcccctccgtttgacgtcgacgacccctccatggccactttctcttattat
gtccgttactgggaaaagggaggaatcgaacaggtcaaaggccccttcaagagcaactcc
attgtgctggatgatttaaaacctttacgagtatactgtttacaagtcaaggccgaactg
ttttggaattcattcaacatccgtagacctgggcattttagtgacgtaacttgccgcgaa
acgacaatcgatgcctccaccaagcttcaacaagacgtcctgatcgccataggaaccttt
ctggtgctggcgatgctggcagtgccctgtctcttcctggtcctgaaatacagaggcctg
attaagtactggtttgagtctccaccaagcatccctctacaaatagaagagtatttaaag
gacccggcgcagcctatcttagaggccctggacaaggacagctcaccaaaggatgacacc
tgggactctgtgtccgtcatttcatttccagagaaggagtga

KEGG   Pteropus alecto (black flying fox): 102878027
Entry
102878027         CDS       T02993                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha
  KO
K05055  interleukin 6 receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04066  HIF-1 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04659  Th17 cell differentiation
pale04932  Non-alcoholic fatty liver disease
pale05163  Human cytomegalovirus infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102878027 (IL6R)
   04066 HIF-1 signaling pathway
    102878027 (IL6R)
   04151 PI3K-Akt signaling pathway
    102878027 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102878027 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102878027 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102878027 (IL6R)
   04659 Th17 cell differentiation
    102878027 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878027 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102878027 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102878027 (IL6R)
   05163 Human cytomegalovirus infection
    102878027 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102878027 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102878027 (IL6R)
   04090 CD molecules [BR:pale04090]
    102878027 (IL6R)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102878027 (IL6R)
CD molecules [BR:pale04090]
 Proteins
  102878027 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind ig fn3 Ig_2 Ig_3 Ig_6
Other DBs
NCBI-GeneID: 102878027
NCBI-ProteinID: XP_024896616
LinkDB
Position
Unknown
AA seq 486 aa
MLLDHGEDGLPAPPQSGCLVLKPLVAAPLQKRSPLLGRLWANQVSSVSPEVENDVLTSRP
GASVNLTCPGWDPRDNATFHWVLRSRGAGSHHSRWAGMGRTLLLRSVQLNSSGNYLCYQD
GRWAGTVHLLVEAPPEEPQLSCFRKSPLSNVDCEWSPGSAPSPTTKAVLLVRKFQHSPVG
DFQEPCLYAQESQKFSCQLAVPEGDNSFYIVSLCVANHAGSASSRPQTFEGYEILQPDPP
VNITVTPVDRNPRWLSVTWQDAPSWNSHFYRLQFELRYRAEKSKVFTTLLVKEPRHRCTI
HDAWSGMRHVVQLRAQEEFGHGLWSEWSQAVLGTPWTGIAASPAERRLFQALTTHEDDED
TLPHEPANATSIPGPAASFVPLHTFLVAGGSLVFGTLLCVGIVLRFKKTWRLQAAKEGGA
GAHSPCSLGQLVPERPKPAPGLVPLISPPVSPSSPGSDNTSGHSRPDARGPHSPYDVSNT
DYFFPR
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgctgctcgaccacggcgaggacgggctccctgcccctcctcaatcggggtgtttggta
ctgaagcctctggtggctgccccgcttcagaaacgaagtcccctcctcggtcggttgtgg
gccaaccaagtgtcttctgtctccccagaggtggaaaacgacgtgctgaccagcaggccc
ggggccagtgttaacctgacctgcccgggatgggacccgagggacaacgccaccttccac
tgggtgctcaggagtcggggcgcaggctcccaccacagccgctgggccggcatggggagg
acactgctcctgaggtccgtgcagctcaatagctctgggaactatttgtgctaccaggat
ggccgctgggccgggaccgtgcacctgctggtggaggcccctcccgaggagccccagctc
tcctgcttccggaagagccccctcagcaacgtggactgtgagtggagcccggggagcgcc
ccctccccaacgaccaaggccgtgttgttggtgaggaagttccagcacagccccgtggga
gacttccaggagccgtgcctgtatgctcaggagtcccagaagttctcctgccagctggcg
gttccggagggggacaactctttctacatagtgtcgctgtgcgtcgccaaccacgctggc
agcgcgtccagcagaccccagacgttcgagggttacgaaatcctgcaacctgacccacct
gtcaacatcacggtcaccccggtggacagaaacccccgctggctcagtgtcacctggcaa
gacgccccctcctggaactcgcatttctacaggctgcagttcgagctccggtaccgggcc
gagaagtccaaggtcttcacgactctgctggtcaaggagccccggcatcgctgcaccatc
catgacgcctggagtggcatgaggcacgtggtgcagctgcgggcccaggaggagtttggg
cacggcctgtggagcgagtggagccaggcggtcctgggcaccccctggacaggtatcgcg
gcctcgccggcagagcgacgtctctttcaggcgctcacgactcacgaggacgatgaagac
acgctccctcacgaacctgcaaatgcgacaagcatcccagggccggccgcctccttcgtg
cccctccacaccttcctggtggccggagggagcctggtcttcggaactctcctctgcgtg
ggcatcgtcctgaggttcaagaagacgtggaggctgcaggccgccaaagagggcggggcg
ggcgcgcactcaccctgctccctcggacagctggtccccgagaggccgaagcccgcccca
ggactcgtgcccctcatctcgccgccggtgtcccccagcagccctgggtcggacaacacc
tcggggcacagccggccggacgccaggggcccacacagcccttacgacgtcagcaacaca
gactacttcttccccagatag

KEGG   Pteropus alecto (black flying fox): 102878242
Entry
102878242         CDS       T02993                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102878242 (IL3RA)
   04151 PI3K-Akt signaling pathway
    102878242 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102878242 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102878242 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102878242 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878242 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102878242 (IL3RA)
   04090 CD molecules [BR:pale04090]
    102878242 (IL3RA)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL3 receptor family
   102878242 (IL3RA)
CD molecules [BR:pale04090]
 Proteins
  102878242 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 102878242
NCBI-ProteinID: XP_024905531
LinkDB
Position
Unknown
AA seq 365 aa
MKCEASNYTVHVTLRDGSVFSTWIQYLEQEGEPGSAAEHLDCWVHDVHVLTCSWQVGREA
PRDVQYHLYLENAPGHGPRLIAKRALGYRSTEQRWPCPQYTANDQGTYVQCRFGNISGFA
STQYRLLVNGTSKDSRIRCSELVTPLSYIEKLTAPNMTGSCNESDSIMEWKMSSHLNTNF
NYELEIQKGTDAPYIQKVSVPCPGRPEHREGDEPRVSELALPSPQSQTLLPTEVWKTSFV
LSSPRVYTARIRALVSDLPPGQWSAPQRFVLVLAVRRPQDPRRLQCCPFPLRHCGPRRSR
LGLRPTCRNFSSRRCSVQHKLFPPIPRTKNPLSDDTQDEKMINWEGSRAGQEECPVADVQ
VLGET
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaaatgcgaagcgtcaaactacaccgtccacgtcaccctgagggacggctccgtgttc
tccacgtggattcagtacctggagcaagaaggggagcctgggtcggcggccgaacacctg
gactgctgggtgcacgacgtccacgtcctgacgtgcagctggcaggtgggcagggaggcc
ccgagggacgtccaatatcacttgtacctggagaatgctcccgggcacgggccccggctc
atcgctaaacgtgcccttggttaccgcagcactgagcagcggtggccgtgtccacagtac
acagccaacgaccaggggacatacgtccagtgtcgcttcggtaacatctctgggttcgcc
agcacccaataccgcttactggtgaacggaaccagcaaggactccagaatacgctgctcg
gaactcgtcacccctttgtcctacatcgagaaactgactgcacccaacatgacgggcagc
tgtaatgagtccgactctatcatggaatggaagatgtcaagccacctaaatacgaacttc
aactatgaactcgaaatacaaaagggcacagacgccccctacatacagaaggtgagtgtc
ccctgcccgggccgccctgagcatcgcgaaggggacgagccccgggtgtcagagctggcg
ctccccagcccacagagccagacgctgctgcccacggaggtgtggaagacatccttcgtg
ctgagcagcccccgcgtgtacacggcgaggatcagagcgctggtctccgacctgcccccc
ggccagtggagcgccccccagcgcttcgtgctcgttcttgcggtgcggagacctcaggac
cccaggaggctccagtgctgtcccttccccctgcgacactgtggcccccgcaggagccgg
ctggggctgcgtccgacttgcaggaacttctcttcacgcaggtgctcggtgcagcacaag
ctcttccctcccatcccccgcacgaaaaaccccctcagcgacgacactcaggacgagaag
atgattaactgggagggcagcagagctggccaggaggagtgtcccgtggctgacgtgcag
gtcttgggggaaacgtag

KEGG   Pteropus alecto (black flying fox): 102878494
Entry
102878494         CDS       T02993                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102878494
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102878494
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102878494
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878494
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102878494
   04090 CD molecules [BR:pale04090]
    102878494
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL3 receptor family
   102878494
CD molecules [BR:pale04090]
 Proteins
  102878494
SSDB
Motif
Pfam: IL6Ra-bind
Other DBs
NCBI-GeneID: 102878494
NCBI-ProteinID: XP_024905533
LinkDB
Position
Unknown
AA seq 271 aa
MNCSWTKGPAAPDDVQYFLYVQDSKKQWGRECPHYVRESGTHVGCHVPDVSSWASQAYFL
VNGTSRHAKIQFFDSFLWLKTIERCNPPGNISVLCNATHCRILWEKPRTRRRLSDRDFQY
QLQVQQEVRMRVRRAGRRAPRTQGPGHRSGLRGCTAGLRVGAVPERRTPTRRQQTHGRRA
QRPDDVERAKSQLIELPGDLGNKYHLLSPQPRAAHTLRIRAADTRVLQWSAWSQPVTFGS
QESRGRFVYVYVLVVLGTVVCVLAVSCLIQR
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaactgcagctggacaaagggcccagcggcccctgacgacgtccagtattttctatat
gtccaggactcaaagaagcagtgggggagagagtgtcctcactacgttcgggagtcgggc
acccacgtgggctgtcacgtgccggacgtgtcgtcatgggcgtctcaggcgtacttcctg
gtgaacggcaccagccgccacgcgaagatccagttcttcgactcttttctctggttgaag
acaatagagagatgcaacccgcccggcaacatcagcgtgctctgcaacgcgacgcactgc
cgcatcctctgggagaagccgcgcacgcgccgccgcctgtcggaccgggatttccagtac
cagctgcaggtgcagcaggaggtgcgcatgcgcgtgcggcgtgcggggcgccgcgccccg
aggacccagggcccgggacaccggtcggggctgcgcggctgcaccgcggggctgcgggtc
ggggcggttccggagcggcggacaccgacgcggcggcaacaaacgcacggccgcagagcc
cagcggcccgacgatgtggagcgggccaaaagccaactgattgagctgccgggtgatttg
gggaacaagtaccacctgctgagcccgcagcccagagccgcacacacgctgaggatcagg
gccgcggacacccgggtcctgcagtggagtgcctggagccagcccgtcacgttcggctcc
caggaatcgagaggcaggtttgtgtacgtctacgtgctcgtggtcttggggaccgttgtc
tgcgtcctggccgtcagctgccttatccaaaggtaa

KEGG   Pteropus alecto (black flying fox): 102878749
Entry
102878749         CDS       T02993                                 

Gene name
CRLF2
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102878749 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102878749 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102878749 (CRLF2)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL2 receptor family
   102878749 (CRLF2)
SSDB
Other DBs
NCBI-GeneID: 102878749
NCBI-ProteinID: XP_024905534
LinkDB
Position
Unknown
AA seq 398 aa
MVAPAPSEQPRDSLQLHIVNFNFETVQVTWNASQFPAANLTLLYRLTGDPAYSRCAHYIL
RRGRTAGCLLAARGDLILSLSLWDGAASLFNQTLWTSDFWRPQPHEPPEEASAEAEGRAS
EQPWPRHFGRVRCPCRPRWPSRCRVSSPVKPSSPTHLSFQWHQDSVTVTCSNLSYRGLLY
EVQLRSTFDTEWQSREEEACHVTVGGLDADKCYFLRARVRTEESSYGPDTYPSDWSEVAH
LHRGELRESCQDRAFSPKFVSMSAAVVVLTLLLLLLFLWKLRSVKELVMPSVPDPKASFP
GLFEAHRGDFQEWIHDTQNVAVPSKVEPGELACVLEDAPGVPLPTAQAATQRAPASPTPA
HPQLCSREGRGPRGRNAQISSSETPPEPDRGLRTSVCV
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggtggcgcctgcgccttcggagcagccgcgagactccctgcaacttcacatcgtcaac
tttaacttcgaaacggtgcaggtgacgtggaacgcaagccagttcccggcggccaatctg
acgctgctgtaccgcctcaccggggacccggcttacagccggtgtgcccactacattctg
cgacgcggccgcacagccggctgcctgctggccgcacgaggggacttgatcctgagcctg
tccctctgggacggcgcggcttctctgttcaaccagaccttgtggaccagcgacttctgg
cgtccccagccccatgagccgccagaggaagcgtcggcagaggcagagggacgcgcgtcc
gagcagccctggccccgtcatttcgggcgcgtgcggtgcccgtgtcggccgcggtggcca
tcacggtgccgtgtctcgtccccagtgaaacccagctccccgacgcatctgagcttccag
tggcatcaggactcggtgacggtgacgtgctctaacctgtcctacaggggtctgctgtac
gaggtgcaactccgcagcacgttcgacaccgagtggcagtccagggaggaggaggcgtgc
cacgtcaccgtggggggcctggacgctgacaaatgctatttcctgcgggccagagtgaga
acagaggagtccagctacggcccggacacctaccccagcgactggtcagaggtcgcacac
ctgcaccggggcgagctgcgagagtcgtgtcaggaccgagcgttctccccgaagttcgtc
tcgatgtccgccgcggtcgtggtcctgacgctgctgctgctcctgctgtttctgtggaag
ctgcgcagcgtgaaggagctggtcatgcccagtgtgccggaccccaaggcctccttcccg
gggctgttcgaggcgcaccgcggggacttccaggagtggatccacgacacgcagaacgtg
gccgtgccgagcaaggtggagcccggggagctcgcgtgtgtcctggaggacgcaccaggg
gtcccgctgcccacggcccaggcagccacgcagcgagcacctgcctcaccaacgcccgcc
cacccccagctctgcagccgagaggggcgaggcccacgtggccggaacgcacagatttcg
tcctcggagaccccgcctgagcctgaccgcggactccggacctcggtctgcgtctga

KEGG   Pteropus alecto (black flying fox): 102878946
Entry
102878946         CDS       T02993                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1 isoform X1
  KO
K05063  interleukin 12 receptor beta-1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05200  Pathways in cancer
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102878946 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102878946 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102878946 (IL12RB1)
   04659 Th17 cell differentiation
    102878946 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878946 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102878946 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102878946 (IL12RB1)
   04090 CD molecules [BR:pale04090]
    102878946 (IL12RB1)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102878946 (IL12RB1)
CD molecules [BR:pale04090]
 Proteins
  102878946 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 102878946
NCBI-ProteinID: XP_024899658
LinkDB
Position
Unknown
AA seq 728 aa
MGQPVARLVPLLLLLLPQQGAEACGTSECCFQDPPYQDVDSGSSLGSALGPRNLNCYRIF
GAGYECSWEYEGPAAGVRHFLRCCLGPKRCCYFAAGSATKLQFSDQDGVSVLHAVTLWVE
SWAINRTEKSPKVTLKLYSSVKYDPPPRDIKVSGSAGQVRMEWETPARQDGAEVQFRRRT
PGSPWKLGDCGHQDDAGFESCLCPLEIDAAQEFQLRRRRLGPGAPGSPWSSWSSPVCVPP
EIPPQPDVRFLVEPLGPDGRRQVNLHGQLPQIQLPEGCQEPKSGAEVTYRLHLHMLSCSC
KAQATRTLRLRTRLILSGAAYDLAVISWNRFGPGPNQSWHIPAHVHTEPGALNISAEANG
TTMHWPAQAPGLTYCIEWQLHGQDGSPATCTLTVPEDWDHPGTATHHWSPASGAMGQKAC
YLINIFATARPEKPSSWSSVLSTYHFGGNASVVGSPQHISVKTLGPDSVSVDWTPSLLST
CPGVLKKYVIRCQDEDSNQVSELPVKPTETQVTLGGLRAGSTYSVQVRADTATLRGAWSQ
PQHFYIEVQVSKLFDLSIVLISLGSFLSILLLGVLLYLSLNRVLRHLCPPLPTPCASTAV
EFPSSQWKQAWQWPSPADFLEEEEESPKQALVVTMPWDKGDGADLDMPGPFKDKMELPQS
APEPALDTELPLEDRRRVQGYPKAGSLGLSGQDSLEGSPAQVAALPLLLGDLMQRPRSGG
PQHVSLEA
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggggcagccagtggccaggctggtccccctcctccttctcctgctcccccagcagggc
gctgaagcctgcggtaccagcgagtgctgttttcaggacccaccatatcaggatgtagat
tcaggatcttctctaggctcagccttgggccccaggaacctgaactgctaccggatattt
ggtgctggttatgaatgctcttgggagtatgagggccctgcggctggggtcaggcacttc
ctgaggtgctgccttgggcccaagcgttgctgctacttcgctgcaggctcggccaccaag
ctgcaattctctgaccaggatggcgtatctgtgctccatgctgtcacactctgggtggaa
tcgtgggccatcaaccggacagagaagtcgcctaaggttaccctgaagctctatagctct
gttaaatatgaccctccgccaagagacatcaaggtgtcagggtcagcagggcaggtgcgc
atggagtgggagaccccagcccgccaggatggtgctgaggtacagttccggcgccggaca
cctggcagcccatggaagctgggtgactgtggacatcaggatgatgctggcttcgagtca
tgcctttgtcccctggagatagacgcagcccaggaatttcagctacggaggaggcggctt
gggccaggggccccaggaagtccctggagcagctggagcagccccgtgtgtgtccctcct
gaaatccccccacagcccgacgtgaggttcttggtggagccacttggcccagatgggagg
aggcaagtgaatctgcatgggcagctgccccagatccagcttccagaaggctgccaagag
cccaagtctggcgcagaggtgacctaccgcctccacctgcacatgctgtcctgctcgtgt
aaggcccaggccacgaggaccctgcgtctgaggacaaggctcatcctctcgggcgctgcc
tatgacctggctgtcatctcctggaatcgctttggccccggccccaaccagtcatggcat
attcctgcccatgtgcacacagaaccaggagctctgaatatcagtgctgaggccaatggg
accactatgcattggccagcccaggccccgggcctgacgtactgcatcgagtggcagctc
catggccaggatggaagccctgccacctgtaccctgactgtgcctgaagactgggaccat
cctggaacagcaacccaccactggagcccagcgtctggggcaatggggcagaaggcctgt
taccttatcaacatttttgccactgcacgcccggagaagcccagctcatggtctagcgtc
ctgtctacctatcactttgggggcaatgcctcggtggtggggagtccacagcacatatcg
gtgaaaacgcttggcccagactctgtgtctgtggactggacgccgtccctgctgagcacc
tgccccggtgtactgaagaagtatgtcatacgctgccaagatgaggacagcaaccaggtg
tctgagctgcctgtgaagcccacagagacccaggtcacccttggtggtctgcgggctggc
tcaacctacagtgtgcaggtgcgagcagacacagcgacactgaggggcgcctggagtcag
ccccagcacttctacatagaagtccaggtttccaagttgttcgatttgtccattgtcctc
atatctctggggagcttcctgagcattctcctcctgggcgtccttctatacctcagcctg
aacagagtcttgcggcatctgtgcccacccctgcccacaccctgtgccagcactgctgtc
gagttccccagcagccagtggaagcaggcttggcagtggcccagcccagcagacttcctg
gaggaggaggaggagtccccgaaacaagctctggtggtgaccatgccctgggacaaaggt
gacggggctgacctggacatgcctgggcctttcaaggacaagatggagctacctcagagt
gcccctgagccagccctagatacagagctgcccttggaggacaggagacgggttcaagga
taccccaaggctggaagtctgggactcagtgggcaggacagtctggagggcagccctgcc
caggtggctgcactgcccctactcctgggagacctaatgcagagacccaggtccggtggc
cctcagcatgtgagcctggaggcctga

KEGG   Pteropus alecto (black flying fox): 102879707
Entry
102879707         CDS       T02993                                 

Gene name
IFNLR1
Definition
(RefSeq) interferon lambda receptor 1 precursor
  KO
K05140  interferon lambda receptor 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102879707 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102879707 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102879707 (IFNLR1)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL10/28 receptor family
   102879707 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind Chromate_transp
Other DBs
NCBI-GeneID: 102879707
NCBI-ProteinID: NP_001277102
UniProt: G5CBR1
LinkDB
AA seq 515 aa
MTGAARWALLLLYLLQSAPERSCLAPPQNVTLLSQNFSVYLTWLPGPGHLQNVTYVVAYQ
SSAPPRRWQKVKKCAGTKELSCSLMCLEKQDLYNKFKGRVRAVSPSARSPWVESEYLEYL
FQVEPAPPILVVTLTEKILSINATYQLPPCMPPADLKYEVDFWKKGTMNKTRFPVTPHGE
PVQIPLQPATNGQHCLSARTIYTFGDTKYSEFSKPTCFSLEAPRVNWAFLVLLPLLLPLL
LVIVMGHVLWKNFTGNPWFQQAKKPQALDFSGHRHPPATFQPSGPEPLNDLTLYPQKEMT
RKVKLTPRARAPATTHAGSEKDSAAEDKDDDEEDTDDSVSFQPYIEHSRFLKQEHEPPGH
SEAGVRLEGSSAWDSSYRSWTSSVGSSPWDEAGSSGYLAKKGPGQGLDVDGCQEALLLPK
FSEDSGSLHEPLKDDLSSWATWGSLSPNLNLVPGDPPVSLHTLTFCWDSSPEEEEEEEED
ERESEVEDGGASSWAADCLQRTEAKGRTLGCYMAR
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgacaggggctgcgcgctgggccctcctgctcctgtacctgctgcagtccgctccagag
aggtcctgcctggcccctccccagaatgtgacgctgctctcccagaacttcagcgtttac
ctgacatggcttccagggcctggccacctccagaacgtgacctacgttgtggcctatcaa
agctccgcacctcccagacggtggcaaaaagtgaaaaagtgtgcaggaaccaaagagctg
tcatgttctctgatgtgcctggagaaacaggacctctacaacaagttcaagggacgagtg
cgggcggtttctcccagcgccaggtccccctgggtggagtcggagtacctggagtacctt
tttcaagtggagccggccccacccatcctcgtagtcactctgacagagaagatcttgagc
atcaatgccacatatcagctgcccccctgcatgcccccggcagatctgaagtatgaggtg
gatttctggaagaaagggaccatgaacaagacccgatttccagtcactccccatggtgag
ccagtccagatcccgctccagccagccaccaatggacagcactgcctcagtgccagaacc
atctacaccttcggtgacactaaatacagcgagttctccaagcccacctgcttctccctg
gaggctccaagagttaactgggcatttttggtgctgctcccacttctgctgccactgctg
ttggttattgtcatggggcacgtgctctggaagaactttacagggaacccctggtttcag
caggcaaagaagccacaggccctggacttttctggacatagacatcccccagcaaccttt
caacccagcggcccagagcccctgaatgacttgaccctctatccccaaaaggaaatgacc
agaaaggtcaagctgactcctagagccagggccccagctaccacccatgcaggatcagag
aaagacagtgctgcggaggacaaggatgatgacgaggaggacacagatgacagcgtcagc
ttccagccctacattgaacactcccgcttcctgaagcaggagcacgagcccccggggcac
tctgaggcaggggttcggctcgaaggctcctctgcgtgggactcttcatacagaagctgg
accagctctgtgggctcctccccctgggatgaggctgggtcttctggctatttggccaag
aaggggccaggccaagggctggatgtggatgggtgtcaggaggctctcttactccccaaa
ttctccgaggactcgggttccctgcatgaacccctaaaagatgacctctcttcctgggct
acctggggttccttgtcaccaaacctgaatctggtccctggagatcccccagtttctctt
cacacactgactttttgctgggacagcagccccgaggaggaggaggaggaagaagaggat
gagagggaatcagaagttgaggacggtggtgccagcagctgggcagctgactgcctccag
aggactgaggccaagggtaggacactggggtgttacatggccaggtga

KEGG   Pteropus alecto (black flying fox): 102879846
Entry
102879846         CDS       T02993                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102879846 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102879846 (IL22RA2)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL10/28 receptor family
   102879846 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 102879846
NCBI-ProteinID: XP_006915486
UniProt: L5KDB3
LinkDB
Position
Unknown
AA seq 231 aa
MTPKHCFLGFLVSFFLTGVAETQPAHESLKPQTAYFQSRNFYNILHWQPGRACANNSSVY
FVQYKVYGQKQWINKEDCWGIQEFFCDLTNETSEAQEAYYGRVRTASAGIHSGWTMTQRF
SPWWETKIDPPVMNITQVNGSLLVILHAPNMPYRNQKGKNVSMENSYELVYRVFIINNSL
EKKRKVYEGAHGVVELEALTPHTSYCVVAEIYQPMLDRSSQKSEEKCVETP
NT seq 696 nt   +upstreamnt  +downstreamnt
atgacgcctaaacattgctttctaggcttcctcgtcagtttcttcctgactggtgtagca
gaaactcagcctgcccatgagtctctgaagcctcagacagcatattttcaatcacgaaat
ttttataacattttgcactggcagcctgggagggcttgtgccaacaacagcagcgtctac
tttgtgcagtataaagtgtatggacagaaacaatggataaataaagaggactgttggggt
attcaagaattcttttgcgaccttaccaatgaaacctcagaagcacaggaggcttattac
ggaagggtgaggacagcttcagctggtatccactcaggctggaccatgacgcagcgtttc
tctccctggtgggaaacaaaaatagatcctccagtcatgaatataacccaggttaatggc
tctttgctggtgattctccatgctccaaacatgccatatagaaaccagaaaggaaaaaat
gtatcaatggaaaattcctatgagctggtataccgagtctttataattaacaattcccta
gaaaagaagcgaaaggtatatgaaggagctcatggagttgttgaacttgaagctctaaca
cctcacactagttactgtgtagtagctgaaatatatcagcccatgctagacagaagcagc
cagaaaagcgaagagaaatgtgtggaaactccttga

KEGG   Pteropus alecto (black flying fox): 102879965
Entry
102879965         CDS       T02993                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102879965 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102879965 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102879965 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102879965 (IL22RA1)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL10/28 receptor family
   102879965 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 102879965
NCBI-ProteinID: XP_006924491
UniProt: L5JT48
LinkDB
Position
Unknown
AA seq 581 aa
MRTLLTILAAGSLVAHIAEDTSDLLQHVKFQSSNFENILTWDSGPESTPDTVYSVEYKTY
GEVEWLVKTGCQRITRKSCNLTMETSNLTEQYYARVTAISTGGRSATKMTDRFSSLQHTT
IKPPDVTCIPKVRSIQMIVHPTSTPFYTGDGHQQTLEDIFQDLFYRLDLYVNHTYQMHLG
GKQREYEFIGLTPDTEFLGTIIIFVPTWSKESAPYMCRVRTLPDRTWTYSFSGAFLFSMG
FLVAGLCYLCYRYVTKPPPPPNSLNIQHVLTFQPLQFIQEHILIPALDLSSPSSLAQPVQ
YSQVMVSGPREPRGAPSRHSLSEITYIGQPDISILQLPGMPSHQTLSPISYAPQATPEVT
PPSYTPQVTPEAKPPSYTPQASCKVQPPSYNPQASLDSWPLSYGICMEGSGKDSPPVTRS
SPKHHRLKGQLQEEAPAGSCIACDLSLQGVASLAMEELQEAKYFHQHLVVETERGPDTNV
PPRGEPGTPRYLKGQLPLLSSVQIEGQPVSLPLHTPPLPCSPTDQISSPWGLLESLVCPK
DEGPVSETEVESPSPRASDQEQPTELDSLFRGLALTVQWES
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaggacgctactgaccatcctggctgcgggatccctggtcgctcacattgctgaggac
acctcggatcttcttcagcacgtgaaattccagtccagcaacttcgaaaacatcctgact
tgggacagcggaccggagagcaccccagatacagtctacagtgtcgagtataagacgtac
ggagaggtcgagtggctggtgaagacgggctgccagcggatcacccggaaatcttgcaac
ctgaccatggagaccagcaacctcacagaacaatactatgctagggtcaccgccatcagc
acgggaggtcggtcagccaccaagatgaccgaccggttcagctcactgcaacacactact
atcaaaccacctgatgtgacctgtatccccaaagtgagatccatccagatgattgtccat
cccacctccacgcccttctacacaggggatggccaccagcagaccctggaggatatcttc
caagatctattctaccgcttggacctctacgtcaaccatacctaccaaatgcaccttgga
ggaaagcagagagaatacgagtttattggcctgacccctgacaccgagttccttggaacc
atcataatttttgttcccacctggtccaaagagagtgccccctacatgtgccgagtgagg
acattgccagaccggacgtggacctactccttctcgggcgccttcctgttctccatgggc
ttcctagtagcagggctctgctacctgtgctacagatatgtcaccaagccgcctccgcct
cccaactccctgaacatccagcatgtactgaccttccagcctctgcagttcatccaggag
cacatcctgatccccgccttagacctcagcagccccagcagcctggcacagcctgtccag
tactcccaggtcatggtctctgggcccagggagccccgaggagccccatcgcgacacagc
ctgtctgagatcacctacatcgggcagccagacatctccatcctccagctccctggaatg
ccgtctcaccagacactctctccgatatcctatgctcctcaggctacccctgaggtcacg
cccccatcctacacacctcaagtcacccccgaagctaaacccccatcctacactccacag
gcctcctgcaaggtccagcctccttcctacaaccctcaagcctcgctggacagctggcct
ctttcctatgggatatgcatggaaggctctggcaaagactccccacctgtgacacgctct
agtcccaaacaccacaggcttaaaggtcagctccaggaagaagcaccagctggaagctgc
atcgcatgtgacctttctcttcagggagtggcctccttggctatggaggagctccaagaa
gcaaaatatttccaccagcatctggtggttgaaacagagagaggacctgacactaatgta
ccacccagaggggagccaggaacaccaaggtacctaaaaggccagttgcctctcctctcc
tctgtccagattgagggccaaccagtgtccctccctctacacactcctcccctcccatgt
tcccctacagaccagatttcaagtccctggggtctgctggagtctctcgtgtgtcccaag
gacgagggtccagtgtctgagactgaggtcgagagcccgtcccctcgagcctcagaccag
gagcagcccacagaactggactctctcttcagaggcctggccctgactgtgcagtgggag
tcgtga

KEGG   Pteropus alecto (black flying fox): 102880336
Entry
102880336         CDS       T02993                                 

Gene name
MPL
Definition
(RefSeq) thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102880336 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102880336 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102880336 (MPL)
   04090 CD molecules [BR:pale04090]
    102880336 (MPL)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  Prolactin receptor family
   102880336 (MPL)
CD molecules [BR:pale04090]
 Proteins
  102880336 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind FxsA LapA_dom
Other DBs
NCBI-GeneID: 102880336
NCBI-ProteinID: XP_024902203
LinkDB
Position
Unknown
AA seq 645 aa
MPSWALLMITSCLFLAPQNPAQVTNQDASLLASDSEPLNCFSRTFEDLTCFWDEEETAPS
GIYQLLYAYPGEEPRACPLSSQSVPPFGTRYVCQFPAQDEVRLFFPLHLWVKHVFLNQNL
TQRVLFVDRVGLPAPPSIIKATGGSRPGELQISWEAPAPEISDFLRHELRYGPKDPRNST
GPTVMQLLSTETCCPALRRPNPATALDQSACSQPLMPQKDGPEQTSPTREVPSLTVMGGS
CLISGLQPGNSYWLQLRSQPDGVSLQGSWGPWSLPATMDLPGDAVEIGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRPQCCPRDRDPIWEKCEEEEKNPELQPSQFTRCHFKSRNDSV
IHILVEVTTAQGAFHSFLGSPFWIHQAVLIPTPNLHWREVSSGQLELEWQHPSSWAAQET
CYQLRYTGEGHQDWKVLEPPLGAQGETLELRPRSRYRLQLRARLHGPTYQGPWSAWSDPV
RLETASEMAWISLVTALLLVLGLSALLGLLLLRWQFLEHYRSLRHALWPSLPDLHRVLGQ
YLRDTAALSLPKAAVSDAYEEVEPSLLEILPKSSEKTPLPLCSSQAQIDYRGLQPSCLGT
IPLSVCPPVAEMGSYCTTHIANHSYLPLTCWQAPHSQYPGQVQTL
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcttgatgatcacctcctgcctcttcctggccccccaaaaccca
gcacaagtcaccaaccaagatgcttccttactggcctcggactcggagcccctgaattgt
ttttctcgaacatttgaggacctcacttgcttctgggatgaggaagagacagcacccagt
ggaatataccagctgctgtatgcctacccaggggaggagccccgtgcctgccccctgagt
tcccagagtgtgcccccctttggaacccgatacgtgtgccagtttccagcccaagatgaa
gttcgcctcttctttccgctgcacctctgggtgaagcatgtgttcctgaaccagaatctg
acccagcgggtgctatttgtggatagagtgggcctgccagctccccccagtatcatcaaa
gccactggtgggagccggccaggggaacttcagatcagctgggaggccccagctcccgaa
atcagtgatttcttgaggcacgaactccgctatggccccaaggatcccaggaattctact
ggtcccacagtcatgcagctgctgtccacagaaacctgctgcccagctctgcggaggcca
aacccagccacagctctggaccaatctgcatgttctcaacctttgatgccccaaaaggat
ggaccagagcagacttccccaactagagaagttccatctctaacagtgatgggtggaagc
tgcctcatctcagggctccaacctgggaactcctactggctccagctgcgcagccaacct
gatggggtctccctccaaggctcctggggaccctggtccctccctgcaaccatggacctg
cctggggatgcagtggaaattggactgcaatgctttactctggacttgaagaatgtcacc
tgtcagtggcagcaacaggaccatgctagctcccaagggttcttctatcacagcaggcca
cagtgctgcccgagagacagggaccccatctgggagaagtgtgaagaggaggagaaaaat
ccagaattacagccctcccagttcacccgctgccatttcaagtcacgaaatgacagtgtg
attcatatccttgtggaggtgaccacagcccagggtgcttttcacagtttcctggggtcc
cctttctggatccatcaggctgtgctcatccccactcccaatttgcattggagggaggtc
tccagtgggcagctggaattggaatggcagcacccatcatcctgggcagcccaagagacc
tgctatcagctccgatacacaggagaaggacatcaggactggaaggtgctggagccgcct
ctcggggcgcagggagagactctggagctgcgcccgcgctcccgctaccgtttacagctg
cgcgccaggctccacggccccacctaccaaggcccctggagcgcctggtcagacccagtg
aggctggagaccgcttccgagatggcctggatctccttggtgaccgctctgctactggtg
ttgggcctcagcgccctcctgggcctgctgctgctgaggtggcagtttcttgagcactac
aggagcttgaggcatgccctgtggccctcacttccagacctgcaccgggtcctaggccag
taccttagggatactgcagccttgagtctgcccaaggctgccgtctcagatgcctatgag
gaagtggaacccagcctccttgaaattctacctaagtcctcagagaagactcccttgccc
ctatgttcctcccaggcccagatagactaccgaggattacagccctcttgcttggggacc
atacccctgtctgtgtgcccacctgtagctgagatggggtcctactgtaccactcacatt
gccaaccattcctacttacctttgacctgttggcaggcccctcactcccagtaccctgga
caggtccaaaccctctag

KEGG   Pteropus alecto (black flying fox): 102880415
Entry
102880415         CDS       T02993                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta isoform X1
  KO
K05060  interleukin 6 signal transducer
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04630  JAK-STAT signaling pathway
pale04659  Th17 cell differentiation
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102880415 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102880415 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102880415 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102880415 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102880415 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102880415 (IL6ST)
   05203 Viral carcinogenesis
    102880415 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102880415 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102880415 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102880415 (IL6ST)
   04090 CD molecules [BR:pale04090]
    102880415 (IL6ST)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102880415 (IL6ST)
CD molecules [BR:pale04090]
 Proteins
  102880415 (IL6ST)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 102880415
NCBI-ProteinID: XP_006912531
LinkDB
Position
Unknown
AA seq 918 aa
MLTLQTWTVQALLIFLTTESLGELLDPCGYIIPESPVVQLGSNFTAVCVLKEKCMDYFHV
NADYIFWKTNHVTVPHEQYTVINRTASSVTFTDISLLNIQLTCNIRIFGQIDQNVYGIRI
ISGLPPEKPKNLSCIVNEGKRMMCQWDPGRETYLETNFTLKSEWATEKFADCKTKRDTPA
SCTVDYSPVYFVNIEVWVEAENALGKVTSDHINFDPVDKVKPNPPRNLSVSNSEELSSIL
KLTWINSSIMGYIRLKYNIQYRTKDASTWSQIPPEDTASARSSFTVQDLKPFTEYVFRIR
CMKEDGKGFWSDWSAEANGITYEDRPSKAPSFWYKMEPSHTHGYRSVQLIWKTLPPFEAN
GKILDYEVTLTRWKSRLQTYSVNDTKLTVNLTNDHYIATLTARNLVGKSDVSVLTIPACD
FQATRPITDLKAFPKDNMLWVEWTAPNESVNKYVLEWCILSDKSPCIPDWQQEDGNVHRT
YLRGNLAESKCYLITVTPVYADGPGSPKSIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWE
QLPVDVQNGFIRNYTIFYKTNIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLITLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQIYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIS
TEGHSSGIGGSSCMSSSRPSISSSDENESAQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEELQLVDNVDGNDGILPRQQYFKQNCSQHETSPDISQFERSKHVSSI
NEEDFVRLKQQQISDISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETFGMEAVIDEG
MPKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttgacattgcaaacttggacagtgcaagccttgttaatttttctcaccactgaatct
ttaggtgaacttctagatccatgtggttatatcatccctgaatctccagttgtacaactt
ggttctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgctgattacattttctggaaaacaaaccatgtcactgttcctcatgaacaatatact
gtcataaacagaacagcatctagtgtcacttttacagatatatctttattaaatattcaa
ctcacgtgcaatattcgtatatttggacagattgatcagaacgtttatggaatcagaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaatgaaggaaag
agaatgatgtgtcagtgggatcctggaagggaaacatacctggaaacaaacttcacttta
aaatctgaatgggcaacagagaagtttgctgattgtaaaacaaaacgtgacacccctgcc
tcatgcactgttgattattctcctgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacatcagatcatatcaattttgatcctgtagataaagtg
aagcccaatccaccacgtaatttatcagtcagcaactcagaggaactgtctagtatctta
aaattgacatggatcaactcaagtattatgggttatataagactgaaatataacattcag
tataggaccaaagatgcttcaacttggagtcagattcctcctgaagatacagcatctgcc
cggtcttcattcactgttcaggatcttaaaccttttacagaatatgtgtttaggattcgt
tgtatgaaggaagatggtaaaggattctggagtgactggagtgcagaagcaaatgggatt
acatatgaagatagaccatccaaggcaccaagtttctggtataaaatggagccatcccat
actcatggctatagatctgtacagcttatatggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactcttacaagatggaagtcacgtttacaaacttac
tcagttaatgacacaaaactgacagtaaatctcacaaatgatcactatatagcaactctg
acagcaagaaatctggttggcaaatcagatgtatctgttttaactatccctgcctgtgac
tttcaagctactcgccccataacggaccttaaagcatttcccaaagataacatgctctgg
gtagaatggactgctccaaatgaatctgtaaacaaatatgtacttgaatggtgtatatta
tcagataaatcgccctgtatcccagactggcaacaagaagatggtaatgtacaccgcacc
tatttaagagggaacctagcagagagcaaatgttatctgataacagttactccagtatat
gctgatggaccaggaagccccaaatctataaaggcataccttaaacaagctccaccttcc
aaaggacctactgttcggacaaaaaaagtggggaaaaatgaagctgtcttagagtgggag
cagcttcctgttgatgttcagaatggatttatcagaaattatacaatattttataaaacc
aatattggaaatgaaaccgctgtgaatgtggattcttcccacacagaatatacactgtcc
tctctgacaagtgacactttatacatggtacgaatggcagcgtacactgacgaaggtgga
aaggatggtccagaattcacatttactactccaaagtttgctcaaggagaaattgaagcc
atagttgtgcctgtttgcttagcatttctattgataacccttttgggagtattgttctgc
tttaataagcgagacctaattaaaaaacacatctggcctaacgttccagatccttcaaag
agtcatattgcccagtggtcacctcacacacctcctaggcataattttaattcaaaagat
caaatatattcagatggcaatttcactgatgtaagtgttgtggaaatagaagctaatgac
aaaaagccttttccagaagatctgaaatcattggacctattcaagaaggaaaaaattagt
actgaaggacacagcagtggtattggagggtcttcatgcatgtcatcttctagaccaagc
atttctagcagtgatgaaaatgaatctgcacaaaatacttcaagcactgtccagtattcc
actgtggtgcatagtggctacagacaccaagttccatcagtccaagtcttctcaagatcc
gagtccacccagcccttgttagattctgaagaacggccagaagagctacagttggtagat
aatgtagatggcaatgatggcattttgccaaggcaacagtatttcaaacaaaactgcagt
caacatgaaaccagtccagatatttcacaatttgaaaggtcaaagcacgtctcatcaatc
aatgaagaagattttgttagacttaaacagcagcagatttcagatatttcacagtcctgt
ggatctgggcaaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtccaggt
actgagggacaagtggagagatttgaaacatttgggatggaggctgtgattgatgaagga
atgccaaaaagttacttaccgcagactgtaagacgaggtggatacatgcctcagtga

KEGG   Pteropus alecto (black flying fox): 102882035
Entry
102882035         CDS       T02993                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin-20 receptor subunit beta isoform X1
  KO
K05137  interleukin 20 receptor beta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102882035 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102882035 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102882035 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102882035 (IL20RB)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL10/28 receptor family
   102882035 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 102882035
NCBI-ProteinID: XP_006907272
LinkDB
Position
Unknown
AA seq 444 aa
MVLEEILPSLMWFFYALIPCLLVDGVAILPAPQNLSVQSTNMKHLLMWNPVTVPGEVIDY
SVEYQGEYETLYVSHIWIPSNCCSPTKDPECDITDDITATVPYNLRVRATLGSQSSAWST
LEYPFNRNSTILTPPEMEITKDGFHLVINLEDLGPQFEFLVAYWKREPGAKSFSLACLGA
ADTSVFQINCMISKAYEAGTSLSREHVKMVRSGGIPVHLETMEPGATYCIKAQTFVKAIG
RQSAFSQAECVKVQDAPTWYFLIHLLSRMTTGFGASPTCVTGGETLPLVLALFMFVGFML
ILVVVPLFIWKMGRLLQSSCCPVVVLPDTLKITDSPQKLISCQREEVAACAMTVLSSETL
QGLDLAVLEKRPAEAEEPGLHDIGVMTGKAVFLFSSMDKGQEKSEEPAMSMCRSNCQRQS
CLADRALMGSGDVSLELNLSASTS
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggttctagaagaaatcttgccaagtcttatgtggtttttctacgccttgattccatgt
ttgctcgtagatggagtcgccattctgcctgcccctcagaacctctctgtacagtcaacc
aacatgaagcatcttttgatgtggaacccagtgactgtgcctggagaagtaatcgactat
tctgtggagtaccagggagagtatgagaccctgtacgtgagccacatctggattcccagc
aactgttgctcacccaccaaagatcctgagtgcgacatcactgatgacatcactgcaacc
gtgccatataacctccgcgtcagggccaccctgggctcacagagctcagcctggagcacc
ctggagtacccctttaatcgaaactcaactatcctaactccacctgaaatggaaattacc
aaggatggcttccacctggttattaacctggaagatctggggccccagtttgagttcctc
gttgcctactggaaaagggaacctggtgccaagtcattctctctggcatgtttaggggca
gcagacaccagtgtgttccagatcaactgcatgatttcaaaagcgtatgaagctggcaca
agcctttcgagggaacatgtcaaaatggtgaggagcgggggtattccagtgcacttggaa
accatggaaccgggggctacttactgtataaaggcccagacattcgtgaaggccattggg
aggcagagtgccttcagccaggcagaatgtgtcaaggtgcaagatgctcccacttggtac
ttcctgatccatttacttagtagaatgaccacaggctttggagccagccctacctgtgtg
acagggggagagaccctccccctggtgctggccctgtttatgtttgttggtttcatgctg
atcctggtggtggtgccactgtttatctggaagatgggccggctgctccagtcctcctgt
tgccctgtggtggtgcttcctgacaccttgaaaatcaccgattcaccccagaagttaatc
agctgccaaagggaagaggtggcagcctgtgccatgactgtgctgtcttctgaaactctt
cagggcctggatctagcagtcttggagaagcgcccagctgaagctgaggaacctggtctg
catgacataggagtcatgacgggaaaggctgtgtttctgttttcttccatggacaaagga
caggagaagtcagaagagcctgctatgtccatgtgtagaagcaactgtcagaggcagagt
tgtctggcagacagagcactgatggggtcaggagatgtgtctctagaactgaatctatct
gcatctactagctga

KEGG   Pteropus alecto (black flying fox): 102882664
Entry
102882664         CDS       T02993                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04080  Neuroactive ligand-receptor interaction
pale04152  AMPK signaling pathway
pale04630  JAK-STAT signaling pathway
pale04920  Adipocytokine signaling pathway
pale04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102882664 (LEPR)
   04152 AMPK signaling pathway
    102882664 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102882664 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    102882664 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102882664 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102882664 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102882664 (LEPR)
   04090 CD molecules [BR:pale04090]
    102882664 (LEPR)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  Prolactin receptor family
   102882664 (LEPR)
CD molecules [BR:pale04090]
 Proteins
  102882664 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 102882664
NCBI-ProteinID: XP_024907739
LinkDB
Position
Unknown
AA seq 1166 aa
MTCKKFYVALLHWEFIYVITAFNLAYPITPWRFKLFCMPPNTTYDFLLPAGISKNTSNLN
GHYEAVVEAKFNSSGTYFSNLSFKTTFPCCFWSEQDKNCSVHADNIDEKAFVSTVNSLVF
QQIGANWNIQCWMKEDLKLFICYMESLFKNSVKNYDLKVHLLYVLPEVLEESPLVPQKGS
FQLVQCNCSVRECCECHVPVPKAKLNYTLFIYLKITYGGVVFQSPLMSVQPINIVKPDPP
LGLHMEITDSGNLKVSWSSPTLVPFQLQYQVKYSENSTTSMRKTDEIVSATSLLLDSVLP
GSSYEVQVRGKRLDGPGIWSDWSTPLIFTTQDVIYYPPKILTSVGSNISFHCIYKNENKI
VSSKKIVWWMNLAEKIPESQYNVIDDHVSKVTFPNLNATKPRGKFTYDAVYCCNEYECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSTNAIQSLVGSTLQLRYHRSRLYCSDVPSIH
AISEPKDCHLQRDGFYECIFHPIFLLSGYTMWIRINHSLGSLDSIPTCVVPDSVVKPLPP
SRVKAEFTVKLGLLKISWEKPLFPENNLQFQIRYGLSRNEVQWKMYEVYDAKSKSASLPV
PDLCAVYAAQVRCKRLDGLGYWSNWSIPAYTVVMDINVPVRGPEVWRIIDEDTTKKERNV
TLLWKPLMKNDSLCSVRRYMVKHHTSRNGTWSEDVGNHTKFTFLWTEQAHTVTVLAVNSI
GASFANFNLTFSWPMSKVNIVQSLSAYPLNSSCVILSWTLSPSDYNLMYFILEWKILNED
NEIKWLRIPSSVKKYYVHDYFIPIEKYQFSLHPIFMEGVGKPKIINSFARDDIGKHQNDA
GLYIIVPIIISSSILLLGTLLMSHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFI
KHTESVTFGPLLLEPETISEDISVDTSWKNKDEKVPTAMVSLLFTTPDLEKSSICINDEC
NSANFSEAESTKVTCENESRRQSSVKYATLLSNSKSGETDEEQGLINSSVSKCFSDKNFL
SKDSFSNSSWELETQALFMLSDQHSNIISPHLTFSEELDKLLKLEGNFLEENNDEKTVYY
LGVTSIKKRESAVFLTDESRVLCPFPTHCLFTDLRILQDSCSHLVENNFNVGTSGQKTFI
SYMPQFQTCSTQTQKIMENKMCDLTV
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgacttgtaaaaaattctatgtggctttgttacattgggaatttatttatgtgataacg
gcgtttaacttggcatatccaattactccctggagatttaaattgttttgcatgccacca
aatacaacatatgacttcctcttgcctgctggaatctcaaagaatacttcaaatttgaat
ggacattatgaggcagttgtcgaagctaaatttaattcaagtggtacctacttttctaac
ttatcattcaaaacaactttcccttgttgcttttggagtgaacaagataaaaactgctct
gtacatgcagacaacattgacgagaaggcatttgtttcaacagtaaattctttagttttt
caacaaataggggcaaactggaacatacagtgctggatgaaagaggacttgaaattattc
atctgttacatggaatcattatttaagaattctgtcaagaattatgaccttaaggtccat
cttttatatgttctgcctgaagtgttagaagagtcacctctggtcccccagaaaggcagt
tttcagcttgttcagtgcaactgcagtgttcgtgaatgttgtgaatgtcatgtgcctgtg
ccaaaagccaaactcaactatactctttttatatatttgaaaatcacatatggtggagta
gtttttcagtcacctctaatgtccgttcagcccataaatattgtgaagcctgatccaccg
ttaggtttgcatatggaaatcacagacagtggtaatttgaaggtttcatggtccagccca
actttggtaccatttcaacttcaatatcaagtgaaatattcagagaattctacaacaagt
atgagaaaaaccgatgaaattgtctcagctacatctctgctactagacagtgtgcttcct
gggtcttcatatgaggttcaggtgaggggcaagagactggatggcccaggaatctggagt
gactggagcacccctcttatttttaccacacaagatgtcatatactatccacctaaaatt
ctgacaagcgttgggtccaacatttcttttcactgcatctacaaaaatgaaaacaaaatt
gtttcctcaaaaaagattgtttggtggatgaatttagctgagaagattcctgaaagccag
tataatgttatagatgaccatgttagcaaagttacttttcccaatttgaatgcaaccaaa
cctcgagggaagttcacctatgatgcagtgtactgctgcaatgagtatgagtgccaccat
cgctatgctgaattatatgtgattgatgtcaatatcaatatatcatgtgaaactgatggc
tacttaactaaaatgacttgcagatggtcaaccaatgcaatccaatcacttgtgggaagt
actttgcagttgagatatcataggagcagactttactgttctgatgttccatctattcat
gccatatccgaacccaaagattgccatttgcagagagatggtttttatgaatgcatattt
cacccaatctttctattatctggctacacaatgtggattaggatcaatcactctttgggt
tcacttgattctatccccacatgtgtcgttcctgattctgtggtgaaaccactgcctcca
tctagagtcaaagcagaatttactgtaaaacttggattattgaaaatatcttgggaaaag
ccactttttccagagaataatcttcagttccagattcgttatggtttaagtagaaacgaa
gtacaatggaagatgtatgaggtgtatgatgccaaatcaaaatctgccagcctccccgtg
ccagacctgtgtgcagtctatgctgctcaggtgcgctgtaagaggctggatggactggga
tattggagtaattggagtattccagcttacacagttgtcatggatataaatgttcctgtc
agaggacctgaagtttggagaataattgatgaagacaccactaaaaaagagagaaatgtc
actttactttggaagcccctgatgaaaaatgactcattgtgcagtgtgagaagatacatg
gtaaaacatcatacttcccgaaatggaacatggtcagaagatgtaggaaatcacactaaa
ttcactttcctgtggacagagcaagcacatactgttacagttctggccgtcaattcaatt
ggtgcctcttttgcaaactttaatttaacattctcatggcctatgagcaaagtaaatatt
gtgcagtcactcagtgcttatcctttaaacagcagttgtgtgattctttcctggacgtta
tcacccagtgattacaatctgatgtattttattcttgagtggaaaattcttaatgaagac
aatgaaattaaatggcttagaatcccttcctctgttaagaagtattatgtccatgattat
tttattcccattgagaagtatcagttcagtcttcacccaatatttatggaaggagtgggg
aaaccgaagataatcaatagttttgcccgagatgatattggaaaacaccagaatgatgca
ggtctatatataattgtgccaataattatttcctcctcaatcttgttgcttggaacattg
ttaatgtcacatcaaagaatgaaaaagctgttttgggaagatgttccaaaccccaagaat
tgttcctgggcacaaggacttaattttcagaagccagaaacatttgagcatctttttatc
aagcatacagaatcagtgacatttggccctcttcttttggagcctgaaaccatttcagaa
gatatcagtgttgatacatcatggaaaaataaagatgagaaggtgccaacagctatggtc
tctctacttttcacaactccagatcttgaaaaaagttctatttgtattaatgacgaatgc
aatagtgctaacttctctgaggctgagagcaccaaggtaacctgtgagaatgaaagcagg
agacaatcctctgttaaatatgccaccctgctcagcaactctaaatcaggtgaaactgat
gaagagcaagggcttataaatagctcagtgagcaaatgcttctctgacaaaaattttcta
tcaaaggattctttctcaaatagctcatgggagttagaaacacaggcactttttatgtta
tcagatcagcattccaatataatttcaccacaccttacattctcagaagaattggataaa
cttttgaaacttgagggaaattttcttgaagaaaataatgatgaaaaaactgtctattat
ttaggggtcacctcaatcaaaaaaagagaaagtgctgtgtttttgactgatgaatcaagg
gtgttatgcccatttcccacccactgtttatttactgacctcagaatcctccaggacagt
tgctcacaccttgtagaaaataacttcaatgtaggaacctctggtcaaaagacttttata
tcttacatgcctcagtttcagacttgttccactcaaactcagaagataatggaaaataag
atgtgtgatctaacagtctaa

KEGG   Pteropus alecto (black flying fox): 102882815
Entry
102882815         CDS       T02993                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X1
  KO
K05071  interleukin 4 receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05200  Pathways in cancer
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102882815 (IL4R)
   04151 PI3K-Akt signaling pathway
    102882815 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102882815 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102882815 (IL4R)
   04658 Th1 and Th2 cell differentiation
    102882815 (IL4R)
   04659 Th17 cell differentiation
    102882815 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102882815 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102882815 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102882815 (IL4R)
   04090 CD molecules [BR:pale04090]
    102882815 (IL4R)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL2 receptor family
   102882815 (IL4R)
CD molecules [BR:pale04090]
 Proteins
  102882815 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3 GP40
Other DBs
NCBI-GeneID: 102882815
NCBI-ProteinID: XP_006914109
LinkDB
Position
Unknown
AA seq 824 aa
MGWLGCGLMFPVSCLILVWVAGSGSVKVLHQPTCSSDYISTSTCEWKMDGPTNCSAELRL
SYQLSDDLHSENQTCVTENRASAVCVCDMLMEDVVFSDTYKLDLWAGKQLLWSGSFKPSE
HVKPRAPENLTVHSDVSHMWQLTWSNPYPSDSFLYSKLFYLVNISNEDDPTEFIIFNVTY
VEPTLRFSARTLKSGVFYSARVRALAQSYNSTWSEWSQSIRWFNYYDWPWEQHLPLAVSI
SCILILVILLSCYFSIIRIKKQWWDQIPNPAHSPVMAIVIQESQVSLWGKPSRGQEPAKC
PHWKTCLTKLLPCFLEHGIEKDDSSSKAARNGPLQGPGKSAWPPVEVSKTVLWPECPSVV
KCVELFEAQVESEEEEEMEEDKGGFCPSPESSGCSFQEGREDIAARLTESLFLDLLGGEN
GGFCPQGLGESCLLPPSESRSAQMPRAEFPSAGSQETLFQDQEQPFNPESNPPAALMQSP
DRLAFTEMPAVIADNPAYRSFSNFLSQSSGSGELDSDLLLVECLEEGDPNIPCTHQLSEP
PTVLQPKPETWEQVLRQSVLQHRAAAAPALAPTSGYREFAHAVKQGSAQSTGVAGFSPSG
EAGYKAFSSLLASSAISSETSGVEASRGEGGYRPFQSLSSDCPEAPAPVPLFTFGLDMEL
PHSPQNSVLPSSSPECLILEPVAKGEDSQKPPLSLEQATDPLRDDPGSGIVYSALTCHLC
GHLKQCHGQEERGKAHVVASPCCGCCCGDRSSPPLSPLRNSNPLPDGVPPEASLISASLA
PMGSSEEGKLSLFFQPAHSNAQNSSQTPKVLAMLSTGPICMSAS
NT seq 2475 nt   +upstreamnt  +downstreamnt
atggggtggcttggctgtgggctcatgttccctgtgagctgcctgatcctggtgtgggtg
gcaggctctgggagcgttaaggtcctgcatcagcccacctgctcctccgactacatcagc
acctccacctgtgagtggaagatggacggccccaccaactgcagcgccgagctccgtctg
tcctatcaactgtccgatgatctgcactctgaaaaccaaacgtgtgtcaccgagaacagg
gcaagcgccgtgtgtgtgtgtgacatgctgatggaagatgtggtcttttcggacacctat
aagctggacctttgggctgggaagcagctgctgtggagtggctccttcaagcccagtgag
catgtgaaacccagagcccctgaaaacctcacagttcacagcgacgtctcccacatgtgg
cagctgacttggagcaacccatacccttctgacagtttcctgtactccaaactcttctac
ctggtcaacatttcaaatgaggatgaccccacagagttcataatctttaatgtgacctac
gtggaacccacccttcgcttctcagccaggaccctaaagtctggggtcttctacagtgca
cgggtgagggccttggctcagagctacaatagcacttggagcgagtggagccagagcatc
aggtggtttaactactatgattggccctgggagcagcacctcccgcttgccgtcagcatc
tcctgcattctcatcctggtcatccttctgtcctgttatttcagcatcatcaggattaag
aaacagtggtgggaccaaattcccaacccagcccacagccccgtcatggctattgtcatc
caggagtctcaggtgtcactgtgggggaagccatcccgagggcaggaaccagccaagtgc
ccacactggaagacttgtcttactaagctcttgccctgttttttggagcatggcatagaa
aaggatgacagttcctccaaggctgccagaaacgggcctctccagggtcccgggaaatca
gcatggccccctgtggaggtcagcaagactgtcctctggccagaatgccccagcgtggtg
aagtgtgtggagctgtttgaggcccaggtggagagtgaggaggaggaagaaatggaggaa
gataaagggggcttttgcccgtcacctgagagcagtgggtgcagcttccaagagggcagg
gaggacattgcggcccggctgacagagagtctgttcctggaccttcttgggggtgagaat
ggggggttttgcccacagggcttgggagagtcctgccttcttccaccttcagaaagcaga
agcgctcagatgccccgggcagagttcccaagtgcagggtcccaggagactttgttccag
gaccaggagcagccttttaacccagagtcaaaccctccagctgctctgatgcagagccct
gaccgcctggctttcacagagatgcccgctgttatcgcagacaaccccgcttaccgcagc
ttcagcaacttcctgagccagtcctcaggttccggagagcttgactcagacctactgctg
gtggaatgcctggaggaaggggaccccaacatcccctgtacccaccagctctctgagcca
cccactgtgctccagcccaagccagaaacctgggagcaggtcctccgccagagcgtcctc
cagcacagggcagctgcagcccccgccttggccccaaccagtggctatcgggagtttgcg
cacgcagtgaagcagggcagtgcccagagcacaggggtggcaggcttcagcccttctgga
gaagctgggtacaaggccttctccagcctacttgccagcagtgccatctcctcggagaca
tctggggttgaggccagccgtggggaggggggctaccggcccttccagagcctctcttct
gattgccctgaggcccctgcccctgtccctttgttcacctttggactggacatggagcta
cctcatagtcctcagaactcagttctcccaagcagctccccagagtgcctcattctggag
ccagtggcaaagggagaggacagccagaagcctccgctctccctagagcaagccacagac
cccctcagggatgatccgggcagtggcattgtctactcagcgcttacctgccacctatgt
ggccacctgaagcagtgtcacggccaggaggagcgtggcaaggcccatgttgtggccagc
ccctgctgtggctgctgttgtggagataggtcctcacccccgctgagccccctgaggaac
tcgaaccctttgccagatggggttccaccggaggccagcctcatttcagcctccctggca
cccatgggtagctcagaggagggtaagctctccctgttcttccagcctgcccacagcaat
gctcagaactcaagccagacccccaaagtgctggccatgctctctacagggcccatatgt
atgagcgcttcctag

KEGG   Pteropus alecto (black flying fox): 102883062
Entry
102883062         CDS       T02993                                 

Gene name
IL21R
Definition
(RefSeq) interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04659  Th17 cell differentiation
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102883062 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102883062 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102883062 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    102883062 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102883062 (IL21R)
   04090 CD molecules [BR:pale04090]
    102883062 (IL21R)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL2 receptor family
   102883062 (IL21R)
CD molecules [BR:pale04090]
 Proteins
  102883062 (IL21R)
SSDB
Motif
Pfam: EpoR_lig-bind IL4Ra_N
Other DBs
NCBI-GeneID: 102883062
NCBI-ProteinID: XP_015446419
LinkDB
Position
Unknown
AA seq 536 aa
MPPDWAALLLLLMLQSAWGCPDLVCYTDYFQTVTCFLETWTLHPGTLTLTWQDPYGELKD
EVTSCSLYRSTHNATHAKYTCHMDVFHFMADDIFSVNMTDQSGNHSRECGSFVLAENIKP
SPPLNVTVTFSGHYNISWSSKYDFFALKGKLQYELRYRKLGDPWTLSPGRKLISVDSRSV
SLLPLEFHKGSSYELQVRAGPQPGSSYQGAWSDWSDSVIFHTQPEEMKGGWHTDLLYLLL
VFILPVLVYLGLKIRLPWRPWKVPSPEGFFQPLYVGYSGDFKKWVGTPFTASSLELGPWS
PGVLSTLEMHNCCPPPSVAKGLEPTELPEPADLVEVDGVPESGSWGPAPSIDSSLGGLAY
SREQDRPYVLISIDTVIVSDAEGPGAWPCTCGDDGYPALNLDTGLEPGQGTEDLLLGTGA
TVLSCGCVAAGGPAGLGVPLGSLLDRLNLPFEDEEGWAPGPPWGGRPPRGVSDSEAGSPP
AGLDMDTFDSGFAGSDCGSPVECDFTGPRDEGPPRSYIRQWVVMDPPPAGPEPQAS
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgccccccgactgggctgcccttctgctcctgctgatgcttcagagtgcctggggttgt
ccagaccttgtctgctacaccgattacttccagactgtcacctgctttctggagacatgg
accctccaccccggcacgctcaccctcacctggcaagacccgtatggagagctgaaggat
gaggtcacctcctgcagcctctaccggtccacccacaacgccacgcatgcgaagtatacg
tgccacatggatgtgttccacttcatggctgacgacattttcagtgtcaacatgacagac
cagtctggcaaccactcccgggagtgtggcagctttgtcctggctgagaacatcaagcca
tctcctcctttgaacgtgactgtgaccttctcaggacattataacatttcctggagttcc
aagtacgatttcttcgctctcaagggcaagcttcagtatgagttgcggtacaggaagctg
ggagacccctggaccctgagtccagggagaaagctgatctcggtggattcaagaagtgtc
tccctccttcctttggagtttcataaaggctccagctacgagctgcaggtgcgggcaggg
ccccagcccggctcctcctaccagggggcctggagtgactggagtgactcggtcatcttt
cacacccagccagaagagatgaagggaggctggcacactgacctgctgtatctcctactg
gtcttcatcctccctgtccttgtctacttaggcctgaagatccgcctgccttggaggccg
tggaaggtacccagcccagagggatttttccagcccctgtatgtgggctacagtggagac
ttcaagaagtgggtgggcacacccttcactgcctccagcctggagctgggtccctggagc
ccaggggtgctctcgaccctggagatgcacaactgctgccccccgccgagtgtggccaag
gggctggagcccacggagctgccggagcccgcggacctggtggaagtcgacggagtgccc
gagtcaggttcctggggcccagccccctctattgacagcagcttgggcggcttagcctat
agccgggagcaagaccggccttacgtcctgatatccatagacacggtgattgtgtcggat
gcagaggggcccggagcctggccctgcacctgtggggacgacggttacccagccctgaac
ttggacactggcctggagccaggacagggcactgaagacctgctcttgggtacaggggcc
acagtcctgtcctgtggctgtgttgcagctggtggccctgccgggctgggggtccccctg
ggcagtctccttgacagactaaatctgccctttgaagatgaggaaggctgggcccccggg
ccgccctggggtggcaggccgccccgaggggtgtctgacagcgaggcaggctcacctcct
gctggcctggacatggacacgttcgacagtggcttcgcaggctctgactgtggcagccct
gtggagtgtgacttcaccggccccagggacgaagggccccccaggagctacatccgccag
tgggtggtcatggaccctccacctgcaggacctgagccccaggccagctag

KEGG   Pteropus alecto (black flying fox): 102883396
Entry
102883396         CDS       T02993                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04144  Endocytosis
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102883396 (IL2RB)
   04151 PI3K-Akt signaling pathway
    102883396 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102883396 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102883396 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102883396 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102883396 (IL2RB)
   04659 Th17 cell differentiation
    102883396 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102883396 (IL2RB)
   05202 Transcriptional misregulation in cancer
    102883396 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102883396 (IL2RB)
   05162 Measles
    102883396 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102883396 (IL2RB)
   04090 CD molecules [BR:pale04090]
    102883396 (IL2RB)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL2 receptor family
   102883396 (IL2RB)
CD molecules [BR:pale04090]
 Proteins
  102883396 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 102883396
NCBI-ProteinID: XP_015446114
LinkDB
Position
Unknown
AA seq 549 aa
MAAPALSWCLSLLALLLALAVPWVSTAENDTSRFTCFYNSKANISCVWNWDGGLQPTSCR
IHAQPDQRPWNKSCNLLQVGPSSWACNLILGPPNAQKLTAADVINMIVMCLEGKTWRMMT
TQDFKPFDNLRLFAPDSLRVTHTGTQKCNITWTVSQSSHYIENDLEFEVRTRLQDHSWEE
ASLWIIKQNQQWISLETLLPDTRYELQVRVKPQLNSHEVWSPWSQTLAFRTRPAEKETLS
WLGHLMVGLSGACGFVILVYLLASYRHLGLWLKKVLKCHIPDPSEFFSQLSSEHGGDFQK
WLSSPFPSSSFSPSGLAPEISLLEVLDKDAKATQLLLQQQDKGPSPALETSGHSSLTSCF
TNQGYFFFHLPDALEIEACQVYFTYDPCAEEPDEGGSGAPEGSLLPPLPPLPAEDHGYCT
FPPGEDLLLFSPSLPVGPPSTTLRGAGASEERRLPSLHEGVPRDWAPQPLRLPTPGAPDL
VDRQSPLEGIPGVGGEEGPAPRPGEGAGFPWAGPPRQGQVRVPTSCLTLNTDAYLSLQEL
QNQDPAHSL
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcggctcctgctctgtcctggtgtctgtccctcctcgccctcctcctggccctggcc
gtcccttgggtgtccacagcagagaacgacacttccaggttcacatgcttctacaactcc
aaagccaacatctcctgcgtctggaactgggatgggggcctgcagcctacatcctgccgc
atccacgcccagccagatcaacggccctggaacaaatcctgtaatctgctccaagtgggg
ccgtcatcctgggcctgcaacctgatcctcggacccccaaatgctcagaaactgaccgca
gcggacgtcatcaacatgatagtgatgtgcctcgaagggaagacgtggaggatgatgacg
acccaggacttcaagccctttgacaaccttcgcctgtttgcccctgactccctccgagtc
acccacacagggacccagaaatgcaacataacctggaccgtctcccagtcttcccactac
atagaaaacgacctggagtttgaggtccggacgaggctccaggaccatagctgggaggag
gcctccctgtggattatcaagcagaaccagcaatggatcagcctggagacactccttcca
gacacccgatatgagcttcaggtgcgagtgaagccccagctcaacagccacgaggtttgg
agcccctggagccagaccctggccttcaggacgagacctgcagagaaggagacactctcc
tggctgggccacctcatggtgggcctcagcggtgcctgtggcttcgtcatcttagtctac
ttgctggccagctaccggcaccttggactatggttgaagaaggttctgaagtgtcacatc
ccagacccctcagagttcttctcccagctgagctcagagcacggaggagatttccagaag
tggctttcctcgcctttcccctcatcatccttcagccccagtggcctggcgcctgagatc
tccctgctggaggtgctggacaaggatgccaaggccacacagctgctcctgcagcagcag
gacaaggggccttcgcctgcccttgagaccagtggccactcttcactgaccagctgcttc
accaaccaaggctacttcttcttccacctcccggacgcgctggagattgaggcctgccag
gtgtacttcacctacgacccctgtgccgaggagcccgatgagggggggtctggggcgcct
gaggggtctctcctccctcccctgccgcctctgccagcagaggaccatggctactgcacc
ttcccccccggggaagacctgctgctcttctccccaagtctccctgtcggccccccaagc
acgacactgcggggtgccggggccagtgaagagaggcggcttccctccctgcatgagggg
gtccccagagactgggccccccagcccctgaggcttcccaccccgggagcccctgacctg
gtggatcgccagtcgcctctggagggtataccaggagtagggggagaggagggcccagcc
cctcgccctggggagggggctggcttcccctgggccggccctcccaggcaaggccaggtc
agagtccccacatcctgcctgacgctaaatactgatgcctacctgtccctccaagagctc
cagaatcaggacccagctcactctctgtag

KEGG   Pteropus alecto (black flying fox): 102883479
Entry
102883479         CDS       T02993                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102883479
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102883479
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102883479
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102883479
   04090 CD molecules [BR:pale04090]
    102883479
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL2 receptor family
   102883479
CD molecules [BR:pale04090]
 Proteins
  102883479
SSDB
Other DBs
NCBI-GeneID: 102883479
NCBI-ProteinID: XP_024904183
LinkDB
Position
Unknown
AA seq 482 aa
MGPSRCIWEGWTLESETLMRGMGTWLLGCGWVVLGVLAPGEGGGLGAGTVTCLTNNILRI
DCHWSTPELGQGPSPWLLFTSNHAPGSKHKCVFWVSACTVVLPPEEVLVPSDNFTITLHR
YISGKEQVSLVDPQYLPRRHVKLDPPSDLQSNVSSGSYVLTWSISPALEPLASLLSYELA
FKRQEEVWEQAQCKGHITGVNRLTLEAVELGGDSTYEARLRVQLATLENAVTEQERYEGQ
WSEWSQAVFFPSLQRQDTLISPLGQPNSILVAVTIFLLLTSMTYLLFKLSPRVKSTFYQN
VPSPVAFFQPLYSVHNGNFQTWAGAHRAGMPLSQDYVGAPHGALESSVQEAITSLTYDPA
DSWPSVGLEEEEGTGTGLPADVSSAVLGWEGQLQAYLPQEEWVLVSPTRPAPPQSEGSGS
DYCALPKGCHPLTTPGNTQSSEPIPALACGLSCDQQNLDAQQGASCVGAGPRQRQGPGEQ
AT
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgggacccagcagatgcatctgggaaggttggaccttggagagtgagactctgatgcga
gggatgggcacctggctcctgggctgcggctgggtcgtcttgggagtcctggcaccaggg
gaaggaggagggctgggggctggaactgtcacctgcctcaccaacaacatcctcaggatt
gactgccactggtctaccccagagctgggccagggccccagtccctggctcctcttcacc
agcaaccatgcgccgggcagcaagcacaagtgtgtcttctgggtcagcgcgtgcactgtg
gtgctgccgcccgaggaggtgcttgtgccttctgacaacttcaccatcactttgcaccgt
tacatctctgggaaggaacaggtcagcctggtggacccccagtacctgccccggagacat
gtgaagctggaccctccctctgacttgcagagcaatgtcagctctggctcttatgtcctt
acctggagcatcagtcctgctttggagccgttggcctcgctactcagctatgagctggcc
ttcaagaggcaggaagaggtttgggagcaggcccagtgcaagggccacatcactggggtg
aaccggctcaccctcgaagctgttgaattgggcggcgattccacctatgaggccaggctg
cgcgtccagttggccaccctggagaatgctgtcacggagcaggagcgctacgagggccag
tggagcgagtggagccaggccgtgttcttcccttctctccagagacaggacactctgatc
tcgcctttggggcagcccaacagcatcctcgtcgctgtgaccatttttctcctgctgacc
agcatgacttacctattgttcaagttgtcacccagggtgaagagcaccttctaccagaat
gtgccctctccagtggcatttttccagcctctctacagtgtgcacaacgggaacttccag
acctgggcaggggcccacagagctggcatgccgctgagccaggactacgtcggcgcccca
cacggagccttggagtccagtgtccaagaggccatcacgtcgcttacctatgacccggcg
gattcctggccatctgtgggcctggaggaggaggaaggcactggcaccggcctcccagca
gacgtgtcatcagcagtcctgggatgggaagggcagctgcaggcctacctgccacaggag
gaatgggtccttgtgagccccaccaggccagctcccccacagtcagagggcagtggcagt
gactactgtgccctgcctaaggggtgccacccgttgaccactccaggaaacacacagagc
tctgagcctatcccagccttagcctgtggcctttcctgcgaccagcagaacttggatgct
cagcaaggagcgagctgtgtgggagctggtcccaggcagagacaaggccctggtgaacag
gccacatga

KEGG   Pteropus alecto (black flying fox): 102884262
Entry
102884262         CDS       T02993                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor isoform X1
  KO
K05058  leukemia inhibitory factor receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102884262 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102884262 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102884262 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102884262 (LIFR)
   04090 CD molecules [BR:pale04090]
    102884262 (LIFR)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102884262 (LIFR)
CD molecules [BR:pale04090]
 Proteins
  102884262 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N TMEM154
Other DBs
NCBI-GeneID: 102884262
NCBI-ProteinID: XP_024907926
LinkDB
Position
Unknown
AA seq 1107 aa
MSPKTRTDCIAWMLDVFLYLRQPSWMVDSKRMKTTSNFRWLLSAFVLLYLMNQVNSQKKG
APHDLKCVTNNLQVWDCSWKPSGASRGAVYEVCIENRSPCYRLGKTNTKISTLSPGDHEI
TISPLHGFGSSISKFILNEKNVSFIPDTPEILNLSADFPTSTLHLKWNDKGSVFPHHSNV
IWEIKILHKENVEVIKLMTYNTTLNGKDTVHHWSWTSDMPLECATHYVGIRCYIDDPHFS
GRKEWSDWSPLKNISRSSDLQSKVFPQDKVILVGSDITFCCVTQEKVISAQIGYTKCPLI
HLDGESVAIKIYNISVSENSGTNVVFTTKENIFGTVIFVGYPPDIPQKLNCETHDLKEII
CTWDPGRPTALVGPRNTSYTLFESFSGKYVRFKRVEAPTNESYQLFFQVLPNQEIYNFTL
NARNPLGQSESAILVNTTEKVYPHTPTSVRVKDVNSTAVTLSWHLPGSFAKIKLLCQIEI
NKANSMQELRNVTIKGVENSSYLVAVDKLNPYTMYTFRIRCSSETFWKWSKWSNEKQYLT
TEATPSKGPDTWREWSSDGKNLIIYWKPLPINEANGKILFYNVSCSSDEKTQSLSEIPDP
QHKAEIELDKNDYIISVVAQNSVGSSPPSKIASMEIPNDDLKIEQAVGMGNGILLTWNYD
PNMTCDYVIKWCNSSQSEPCLMDWKKVPSNSTETVIESDQFRPGVRYNFFLYGCRNQGYQ
LLRSVIGYIEELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFEKGERDT
SKMKGLESSRSDVKVKNITDISQKTLRIVDLQGKTSYHLVLRAYTDGGMGPEKSMFVVTK
ENSVGLIIAILIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCE
GNSALKTLEMNPCTPNNVEVLETRTTVPKIEDTEIISPVAEHPEEISDAEPENHVVVSYC
PPVVEEEIPTPGVDETGGTSQVIYIDVQSMYQPQAKPEEEQETDPVGGAGYKPQMHLPVT
STMEDPAAEDDLDTTAGYRPQANVNTWNLVSPDSPRSTDSNSEVVSFGSPCSINSRQFLI
PPKDEDSPKSNGGGWSFTNFFQNKPND
NT seq 3324 nt   +upstreamnt  +downstreamnt
atgtctcctaaaaccaggactgattgcattgcatggatgttggacgttttcttatatttg
agacaaccgtcttggatggtggacagtaaaagaatgaagacaacttcaaatttccggtgg
ctcttatcagcatttgttcttctatatttaatgaatcaagtaaatagccagaaaaagggg
gctcctcatgacttgaagtgtgtaactaacaatttgcaagtgtgggactgctcttggaaa
ccctctggagccagccgtggtgctgtttacgaagtttgcattgaaaacaggtccccttgt
tatcgattgggtaaaacaaatactaaaatctcaactctttcgcctggtgatcatgaaata
acaataagccctctacatggttttggaagttctataagtaaattcatactaaatgaaaaa
aacgtttccttcattccagacacaccagagatcttgaatttgtctgccgatttcccaact
tctacgttacatctaaagtggaatgataagggttctgtttttccacatcactcgaatgtc
atttgggaaattaaaattctacataaagagaatgtggaagtcataaaattaatgacctac
aacacaactctgaatggtaaagatacagttcatcactggagctggacctcagacatgccc
ttggaatgtgccacgcactatgtgggaattagatgctacattgacgatcctcatttttct
ggtcgcaaagagtggagtgactggagcccactgaagaacatttctcggtcttctgatttg
cagagtaaggtttttcctcaagacaaagtgatactcgtgggctcagatataacattttgt
tgtgtgactcaagaaaaagtgatatcagcacagatcggctatacaaaatgtccccttatt
catcttgatggggaaagtgttgcaatcaagatctataatatttctgtttctgaaaatagt
ggaacaaatgtggttttcacaacaaaagaaaacatttttggaacagttatttttgtgggc
tatccacctgatattcctcaaaaactgaactgtgagacacatgatttaaaagagattata
tgcacttgggatccaggaagaccaacagcattggtgggcccacgcaatacaagttacact
ttatttgaaagtttttcaggaaaatatgttagatttaaaagagttgaagcgcccaccaat
gaaagctatcagttattctttcaagtgcttccaaatcaagaaatatataattttactttg
aacgctcgcaatcctctgggtcaatcagaatcagcaattttagttaacacgactgaaaaa
gtttatccccatactcctacttcagtcagagtgaaggatgttaattcaacagctgttaca
ctttcctggcatttaccaggcagctttgcaaagattaaactgttgtgtcaaattgaaatt
aacaaagctaattcgatgcaagagttgcggaatgtcacaatcaaaggagtagaaaattca
agttatcttgttgctgtggacaagttaaatccatatactatgtatacctttcggattcgt
tgttctagtgaaactttctggaaatggagtaaatggagcaatgaaaaacagtatttaacc
acagaagccactccttcaaagggaccagatacttggagagagtggagttctgatggaaaa
aacttaataatatattggaagcctttacccattaatgaagctaatggaaaaatactcttc
tataatgtatcatgttcatcagatgagaaaacacagtccctttcggagatccctgatcct
caacacaaggcagaaatagagcttgataaaaatgactacattatcagtgtggtggcacaa
aattctgttggctcatcgccaccttctaaaatagctagtatggaaattccaaatgatgat
ctcaaaatagagcaggctgttgggatgggaaatgggattctcctcacttggaattacgat
cccaacatgacttgtgactatgtgattaaatggtgtaattcatctcagtctgagccctgc
cttatggactggaaaaaagtcccttcaaacagcaccgaaaccgtaatagaatctgatcaa
tttcgaccaggtgtaagatataattttttcctgtatgggtgcagaaatcaaggctatcaa
ttattacgttctgtaattggatatatagaagaattggctccaatagttgcaccaaatttt
actgttgaggatacatctgcagactcgatattagtaaaatgggaagatattcctgtggaa
gagcttagaggctttttaagaggatatttattttactttgaaaaaggcgagagagacaca
tctaagatgaagggtttggaatcaagtcgttccgatgtgaaggttaagaatattaccgac
atatcccagaagacactgagaattgttgatcttcaaggtaaaacaagttaccatctcgtc
ctgcgagcctacacagatggtggaatgggcccagagaagagcatgtttgtggtgacaaag
gaaaattccgtgggattaattattgccattctcatcccggtggctgtggctgtcattgtt
ggcgtggtaacaagtatcctttgctatcggaaacgagaatggattaaagaaaccttctac
cctgatattccgaatccagaaaattgtaaagcattacagtttcaaaagagtgtctgtgag
ggaaacagtgctcttaaaacactggaaatgaatccttgtaccccaaataatgtcgaggtg
ctggaaactcgaacaacagttcctaaaatagaagatacagaaataatctccccagtagcg
gagcatccagaagagatctcagatgcagaacctgaaaaccacgtggttgtgtcctattgt
ccaccagtcgttgaggaagaaataccgaccccaggagtggatgaaactggagggacctca
caagtcatttatatcgatgtccagtccatgtaccagccccaagcgaaacccgaggaagaa
caagaaaccgaccctgtgggcggggcaggctataagccacaaatgcacctcccagttact
tccaccatggaagatccagcagcagaggatgacttagatacaactgcaggttacagacct
caggcaaatgtaaatacctggaacttagtatctccagactctcccagatccacagacagc
aacagtgaagttgtgtcttttggaagtccgtgttccattaactcccgacaatttttgatt
cctcctaaggatgaagactctcctaaatctaatggaggagggtggtcctttacaaacttt
tttcagaacaaacccaacgattaa

KEGG   Pteropus alecto (black flying fox): 102884525
Entry
102884525         CDS       T02993                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta isoform X1
  KO
K05057  oncostatin M receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102884525 (OSMR)
   04151 PI3K-Akt signaling pathway
    102884525 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102884525 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102884525 (OSMR)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102884525 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 102884525
NCBI-ProteinID: XP_006919561
LinkDB
Position
Unknown
AA seq 971 aa
MALSAVSQATFLLALLSFRTYQSEVLSEPLLLTPESLKVSINSTQQCLHLQWRIHSLTYH
QELKMTFQIEISRIKTSNVIWAEKYSTIVKWDQVLQWSWESELPLECATHFVRVRSTVDD
ARVPEPRFWSSWTSWEEVDVQNSLGHDPLFVFPKDKLVEEGSNVTICYISRSPRNNISCY
LEDVQIYGEQLDPNVSVFNLNNVPFIRKRGTNFFCKVNESDVIKGIVLFVSKVLEEPKDF
SCETRDFKTLKCAWDPGTDTGLPKYSFQSYSLFESFSGKKKVCEHRNWCTWQVARDSQET
YNFTLLAENYLRSRSVNISFNLTHRVHPMTPFNVVLENISATNASMTWKVHSIGNNFTFL
CQIELHGEGKVIQQHNVSIEMNGQYFLSELEPVTEYMTRVRCAAANHFWKWSEWIGQNFS
TLEAAPSKALDVWRNVKSVLGSCTVTLFWRPLSKLHAGGKILFYNVVIENLEKPSSLKLL
SIPAPANGTELTLDQGSYQIYVTANNSMGTSPTSVIVISRDSGSEEVKEGRVQGTEDGFF
MSWKPQSGEAIGYVVDWCDHPRDQACDLQWENLGPKTTSTIISSDAFRPGVRYNFRIYGI
STKKIAYLLERKTGYSKELAPSDNPQVVISNLTSHSFNLSWKDYSIDSQPGFIQGYHVYL
KSKAEQCQPGFEKAVLSDNSVCCKHKIDSPEQKTFLVEHLQPESFYEFLVTPYTSVGEGP
HDTFTKVTTPDEYSHVLIRIILPMIFCLLLIMILCYLKTQWMKEKCYPDIPDPYKSSVLS
LIKSKENPHLTIMNVNDCIPDAIEVVNKPEGRKIQFSGARKSLTETECTKPVYLYLLPTE
NYSSPGPCICFENFTYNQAASDSGSCGHVSIPPEAPPSQLGLLTSPENLLKTLDKNYVNS
LGEISAGESSLNYVSQLASPLSGDKDSFPTNPPMSEYKMQMAVPLGLTSPSPSENSSLSS
IALLDHGEHCR
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggctctctctgcagtctctcaggcaacattcctcttggcgttgctgtccttcagaact
taccagagcgaagtcttatctgaacctttgctattgacccctgagtcactgaaagtttcc
atcaattctacacagcaatgtttgcatttacaatggcgtatccacagccttacttatcat
caggaattaaaaatgacttttcagatagagatcagcagaattaaaacatccaatgtcatc
tgggcggagaagtatagcaccattgtgaagtgggaccaagttctgcagtggagctgggaa
tctgagctccctttggagtgtgcgacgcacttcgtgagagtgaggagtacggtggatgat
gccagggtccctgagccgaggttctggagcagctggacttcatgggaggaagtcgatgtt
cagaattctcttggacatgatccactgttcgttttccctaaagataagctggtagaagaa
ggctccaatgtcaccatttgttacatttccaggagccctcgaaataacatatcctgttat
ttggaagatgtacagatatatggagaacaacttgatccaaatgtgtctgtgttcaacttg
aataatgttcctttcattaggaaaagggggacgaatttcttttgtaaggtgaacgaaagt
gatgttataaaaggcatcgttctctttgtctcaaaagtacttgaggagcccaaggacttt
tcttgtgaaacccgggacttcaagactttgaagtgtgcttgggatcctgggactgacact
ggcttgcctaaatattctttccaaagctacagtttatttgaatcattttctgggaaaaag
aaagtttgtgaacacagaaactggtgtacttggcaagtagctcgagactcacaagaaacg
tataacttcacactcctggctgaaaactacttaagaagtagaagtgtcaatatttctttt
aacctgactcatcgagttcatccaatgactccctttaatgtagtccttgaaaatataagt
gccacaaacgccagcatgacctggaaggtacactccattgggaataatttcacatttttg
tgtcagattgaactccatggtgaaggaaaagtgatacaacagcacaatgtgtccattgag
atgaatggtcagtacttcttaagtgaactggagcctgtcacagagtatatgacccgagta
cgctgtgccgctgctaaccacttctggaaatggagtgaatggattggtcaaaactttagc
acacttgaagcagctccctccaaggctcttgatgtctggagaaatgtgaagtcagtgctg
ggatcttgtacagtaactttattctggaggccactgtcaaaattgcatgctggtgggaag
attctattttataatgtagttatagaaaatctagagaaaccatccagtttaaagctcctc
tccattcccgctccggccaatggcacagaactaaccctcgaccaaggctcgtaccaaatc
tacgtcacagctaataacagtatgggcacttctcccacttctgtaattgtcatctctaga
gactctggaagcgaagaggttaaagaaggaagagttcaaggcacagaggatgggttcttt
atgtcttggaaaccccagtctggagaagccataggctacgtcgtggactggtgtgaccat
ccccgggaccaggcctgtgacctccagtgggaaaacctgggtcccaagaccacaagcacc
atcattagctcagatgcctttagaccaggggtccggtacaacttcagaatttatggcata
tctacaaaaaagattgcttatttgttagagaggaaaacaggatactccaaggaactggct
ccttcagacaaccctcaagtggtcataagtaatttgacttcccactccttcaatctgagt
tggaaggattattccattgactcccaacctggttttatacaaggctaccatgtctacctg
aagtccaaggcagagcagtgccagccaggatttgaaaaggcagtcctttcagataattcg
gtatgttgcaaacataaaatcgacagcccggaacaaaagacatttcttgtggaacaccta
cagccagaatccttctacgagtttttagtcactccatacacaagtgttggcgaaggcccc
catgatactttcaccaaggtcaccactccggatgaatactctcatgtactgatacgtatc
atactccccatgattttctgccttttgctcatcatgatcctgtgctacttgaagactcag
tggatgaaggagaagtgttaccctgacattccagacccttacaagagcagtgtcctgtca
ttaataaaatccaaggagaatcctcatctgacaataatgaatgtcaatgactgcattcca
gatgctattgaagttgtaaacaagccagaaggaaggaagatacagttctcaggtgcaagg
aagtcactcacagaaactgaatgtactaagcctgtctacctttacctcctcccaacagag
aactactccagccctggcccctgcatctgttttgagaactttacctataatcaagcagct
tctgactctggttcttgtggccatgtctcaatacccccagaagctccaccaagtcagctg
ggactactgacttcacctgaaaatttactaaagacactagacaaaaactatgtgaattcc
ctgggagaaatctcagccggagaaagtagtttgaattatgtgtcccagctggcttcgccc
ttgtctggagacaaggacagctttccaacaaatccaccaatgtctgagtataaaatgcaa
atggctgtgccactgggtctcacttcaccttctccgagtgaaaatagcagcctctcctcc
attgcccttttagatcacggtgaacactgccgctaa

KEGG   Pteropus alecto (black flying fox): 102885363
Entry
102885363         CDS       T02993                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04659  Th17 cell differentiation
pale05200  Pathways in cancer
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102885363 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102885363 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102885363 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885363 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102885363 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102885363 (IL23R)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102885363 (IL23R)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Interfer-bind Pur_ac_phosph_N IL12p40_C Lep_receptor_Ig PriX
Other DBs
NCBI-GeneID: 102885363
NCBI-ProteinID: XP_006919363
LinkDB
Position
Unknown
AA seq 627 aa
MNQVTVQWDVIIALYIFFNWCHGGITNINCSGRIWVEPPTIFKMGLNISIYCQAAIKNCQ
PRKLYFYKNGIKERFQITRINKTTARLWYNNFLEPHASMYCTAECPGYFQETLICGKDIS
SGYPPDVPDKVNCVIYEYSGNMTCTWNTGKPTYIDTKYVVYVKSLETKEEQQYLTSNYIN
ISIDSLRGGKNYLVWVQAENVLGMEKSKQLQIHLDDIVIPSASIISRAEDINTTVPKTII
HWDSQTKIENVSCEMRYKATTNQTWNVKEFDTNFTYTQQSAFYLEPNTKYVFQVRCQETG
KSYWQSWSSPFFHKTPETISQVTLKSFQHDTQNSGLLTASIIKGHLTSDDRQQNFGLLLG
MVFFAVVLSILSLIGIFNRSFRTGIKRRILLLIPKWLHENIPNMENSNAAKMLQEKSEFM
NNSSEQVLYVDPVIAEIEIFLPEERKPTDHKKEKNTGSLETRGCLQKSLLTSTTVGYIPD
LSTGYKPQISNFLTEGNHPSNDDETVSSTLKPSVDSLDLGKNARFENSDFAFSVSSVNSL
SNILFREELSLILNQGECSPPDMQNSIEEETTMLLENAPPNETEQTLLPDEFVSCLGIMN
EESPCVNPYFPQNILESHFSRISLLEK
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgaatcaggtcacagttcaatgggatgtgataatagctctttacatattcttcaattgg
tgccatggaggaattacaaatataaactgctctggccgcatctgggtagaaccacccaca
atttttaagatgggtctgaatatttctatatattgccaagcagcaattaagaactgccaa
ccaagaaaactttatttttataaaaatggcatcaaagaaagatttcagatcacaaggatt
aataaaacaacagctcgactttggtataacaactttctggaaccacatgcctctatgtat
tgcactgctgaatgtcccggatattttcaagagacactgatatgcggaaaagacatttct
tctggatatccaccagatgttcctgacaaggtcaactgtgtcatttatgagtattcaggc
aacatgacttgtacctggaataccgggaagcccacctacatagacacaaagtatgtggta
tatgtgaagagtttagagacaaaagaagaacaacaatatctcacctcaaattatattaac
atctccattgattcattacgaggaggcaaaaactatttggtttgggtccaagctgaaaat
gtactaggcatggagaagtcaaaacaactgcaaattcacctggatgatatagtgatacct
tctgcatctatcatttccagggctgaggatataaatactacagtgcccaagacaataatt
cattgggatagtcaaacaaaaattgaaaacgtttcctgtgaaatgagatacaaggctacc
acaaaccaaacttggaacgttaaggaatttgacaccaattttacatatacgcaacagtca
gcattctacttggagccaaacactaagtatgtatttcaagtgagatgtcaagaaacaggt
aaaagctattggcagtcctggagttcaccctttttccataaaacacctgaaacaatttcc
caggtcacattgaaatcattccaacacgatactcaaaattctgggcttcttactgcttcc
atcattaaaggacaccttacttctgacgacaggcaacaaaactttggacttttattggga
atggtcttctttgctgttgtgttgtcaattctttctttgattgggatatttaacagatcg
ttccgaactggaattaaaaggagaatcttattgctaataccaaaatggcttcatgaaaac
attcctaatatggaaaacagtaatgctgcgaaaatgctacaggaaaagagtgaatttatg
aataattccagcgaacaggtcttatatgttgatccagtgattgcagagatagaaatcttt
ctcccagaagaacgcaagcccacagaccacaagaaggagaagaacacaggatccctggag
acgagaggatgcctgcaaaagtcattactcaccagtactacggttgggtatattcctgat
ctgagcactggatataaaccccagatttcaaattttctcactgagggaaaccaccccagc
aatgacgatgaaaccgtttcctcaactctcaaaccatcagttgattccttagacctggga
aagaatgctcggtttgaaaactccgattttgctttttctgtctcaagtgtgaattcgtta
agcaacatactatttcgtgaagaattaagcctcattttaaatcaaggagaatgcagtcct
ccagatatgcaaaactcaatagaggaggaaaccaccatgcttttggaaaatgctccaccc
aatgaaacagaacagaccctgctgcctgatgaatttgtttcctgtttagggattatgaat
gaggaatcgccttgtgttaatccttattttccacaaaatattttggaaagccatttcagt
aggatttcactcttggaaaagtag

KEGG   Pteropus alecto (black flying fox): 102885605
Entry
102885605         CDS       T02993                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2
  KO
K05064  interleukin 12 receptor beta-2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale05200  Pathways in cancer
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102885605 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102885605 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102885605 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885605 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102885605 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102885605 (IL12RB2)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102885605 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind Pur_ac_phosph_N RAG1
Other DBs
NCBI-GeneID: 102885605
NCBI-ProteinID: XP_024907715
LinkDB
Position
Unknown
AA seq 850 aa
MAHTVRVCYLELILNIMLLVVKGKIDVCKRGDVTVKPSHVISLGSAVNISCSLKPKQGCS
QYSSFNRLILYKFDRRIKLQHGYSLSSQVSGLPLGTTLFVCKLACSSSDEIRICGAEISV
GVVPEQPQNLSCIQKGERGTVACTWDRGQDTHLYTAYTLQLNGPKNLTWQKPCNDHYCDH
LDLGINLTPQSPESSYIARVTAINSLGSASSPPSTFTFLDIVRPLPPWDIRIKFVNASVS
RCTLQWRDERLVLLNRLRYRPCSSRSWNMVNTTNAKGRHDLWDLKPFTEYEFQVSSRLHL
YKGSWSDWSESLRVQTPEEEPTGTLDVWYMKQNIGYNRQQISLFWKNLSVLEARGKILHY
QVTLLEVAGGKTTLQNITEHTSWTWVIPRTESWAVAVSAANSKGSSLPTRINITDLCGAS
LLTPGQVSANSEGADNIMVTWDPPGKAASAVKEYVVEWRALHSGVVTQPTLNWLRSPPDN
MAASISENIRPYVCYEIRVHALSGDQGGCSSIRGNSKHKAPVSGPHINAIIEEKGSILIS
WDEIPAQEQMGCVLHYRIYWKEQNSSSQPQLCEIPYGVSPNSHPIDSLQPRVTYVLWMTA
LTAAGESPQGNEKEFCMQGKANWSTIMAPSICIAIIMVGIFSMCYFRQKVFVLLSALRPQ
WCSRQIPDPANSTWAKKYPIVEEKMQLPMDWPTSEEPEPLVIDEVFQVIPVFRRPLHSIW
PEKGRVQDHYTSEEDSVSSPPPQRALTAETGLVDLYKVLESRDSHSKPVKPASSITVLPV
DYLPTHEGYLPSNTDYLPSQEAPITDPLEELEPQHISLSVFSSSLHPLTFSCGEKLTLDQ
LKMGCGSLML
NT seq 2553 nt   +upstreamnt  +downstreamnt
atggcacatacagttagagtgtgctatttggaacttattcttaacatcatgttgctggtg
gttaaaggaaaaatagatgtgtgtaagagaggagatgtgactgtgaagccttcccatgta
atttcccttggatcagctgtcaatatttcgtgctctttgaagcccaaacaaggctgctct
cagtattccagttttaacaggttaatcctttacaaattcgacagaagaatcaagttacag
catggttactctctcagttctcaagtctccggtcttcctctgggtacaacactgtttgtc
tgcaaactagcctgtagcagtagtgatgagattcgaatatgtggagcagagatctcagtt
ggtgttgttccagaacagcctcaaaacttatcctgtatacaaaagggagaacgtggaact
gtggcctgcacctgggacagaggacaagacactcacctatatactgcatatactttacag
ttaaatggacccaaaaatttaacttggcagaagccatgtaatgaccattattgtgaccat
ttggaccttggaatcaacttaacccctcagtcacctgaatccagctacatagccagagtt
actgctatcaacagtcttggaagtgcttcttcacctccatccacatttacattcttagac
atagtgaggcctcttcctccgtgggacatcagaatcaaatttgtaaatgcttctgtgagc
agatgcactcttcagtggagagatgagaggctggtgctgcttaatcgactccgatatcgg
ccctgtagcagcaggtcctggaatatggttaatactacaaatgctaaaggaagacatgat
ttgtgggatctgaaaccgtttacggaatatgaatttcaggtgtcctccaggctacatctt
tataaaggtagctggagtgactggagtgaatcgttgagagtacagacaccagaagaagag
cctactgggacattagatgtctggtacatgaaacagaacattggctacaacagacaacag
atttctcttttctggaagaatctcagtgtattggaggcaagaggaaaaatcctccactat
caagtgaccttgctagaggtggcaggggggaaaactacactacagaatatcacagaacat
acctcctggacttgggtcattcccagaactgagagctgggctgtggctgtgtctgcagct
aactcaaaaggcagttccctgcccactcgtattaacataacggatctgtgtggggcaagc
ctgctgactcccggccaagtctctgcaaactcagagggtgcggacaacattatggtgacc
tgggatcctcccggaaaagctgcctctgctgtcaaggagtacgtggtggagtggagggcg
ctccactcaggggttgtcacgcagcccactctgaactggctgcggagcccccccgacaac
atggctgcttcgatttccgagaacataagaccctacgtctgttatgaaatccgggtgcat
gcattgtcaggggaccagggaggatgcagctccatccggggtaactctaagcacaaagca
ccagtgagtggccctcacattaatgccatcatagaggaaaaggggagcattttaatttcg
tgggacgaaatcccagcccaggagcaaatgggctgcgtcctccattacaggatatactgg
aaggaacagaactccagttctcagcctcaactttgtgaaattccctatggggtctctcca
aattcacatccaattgacagcctacagcccagagtcacctacgtcctgtggatgacagct
ctgacagctgctggtgaaagcccccaaggaaatgagaaagaattttgtatgcaaggtaaa
gccaattggagcacgatcatggcaccaagcatttgcattgctattatcatggtgggcatt
ttctcaatgtgttacttccggcaaaaggtatttgttctcctttcagccctcagacctcag
tggtgcagcagacaaattccagacccagcaaatagcacttgggccaagaaatatcccatt
gtggaggagaaaatgcagctgcccatggactggcccacttctgaagaacctgagcccctg
gtcatcgatgaagtctttcaagtgatcccagtcttcagacgtccccttcattccatctgg
ccagaaaagggacgagttcaagatcactatacttctgaggaagacagtgtctcaagccca
ccacctcaaagagctctcacagcggagacaggactagtggatctgtataaggtgctggag
agcagggactctcactcaaagccagtaaaaccagcgagctccattacggtcctccctgtg
gactaccttcctacccatgaaggttacttaccctccaacacagattatctcccttcacaa
gaggctcctataactgaccccctggaagaactggagcctcagcacatttctctctctgtt
ttctcaagttcccttcacccactcaccttctcctgtggtgaaaagctgactctggatcag
ttaaaaatggggtgcggctccctcatgctttga

KEGG   Pteropus alecto (black flying fox): 102886625
Entry
102886625         CDS       T02993                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102886625 (EPOR)
   04151 PI3K-Akt signaling pathway
    102886625 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102886625 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102886625 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102886625 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102886625 (EPOR)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  Prolactin receptor family
   102886625 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 102886625
NCBI-ProteinID: XP_006905907
LinkDB
Position
Unknown
AA seq 509 aa
MDHLRAPLWPGVGSLCLLLAGVAWAPPPNPLSPKFESKAALLAARVPEELLCFTERLEDL
VCFWEEAASAGIGPDNYSFSYQLEGEQWKPCRLHQAAAGRGAVRFWCSLPTDDTSSFVSL
ELRVTAASSGAPRYRRVIQINEVVLLDPPAELEARRADKGGHVVLRWLPPPGAPMASLIR
YEVNISAGSAAGGAQRVEILDGRTECVLSNLRGRTRYTFMVRARMAEPSFDGFWSAWSEP
ASLLTASDLDPLILTLSLILVLILLLLAVLALLSHRRTLKQKIWPGIPSPESEFEGLFTT
HQGNFQLWLYQNNSCLWNPCTPFTEDPPAPLEVLSERCWGVTQAIERGADDEGPLLKPVG
NEHAKETYLVLDKWLLPQSPPSEDPPRPGGNLDIAALDEGSEASSCSSALALKPEGASAA
SFEYTVLDPSSQLLRPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGDFQGAKGGSSN
GPYSNPYENSLVPAPKPTPRHLHSLHLGL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggatcacctcagggcgcccctgtggcctggagtcggctccctgtgtctcctgcttgct
ggagtcgcctgggctcctccacccaaccccctgagtcccaagttcgaaagcaaagcggcc
ctgctggcggcccgcgtgcccgaagagcttctgtgcttcaccgagcggttggaggacttg
gtatgtttctgggaggaagcagcaagcgccgggatcggccccgacaactacagtttctcc
taccagctcgaaggtgagcagtggaagccgtgccgcctgcaccaggcggccgcaggccgt
ggagctgtgcgcttctggtgctcgttgcctacggacgacacatcgagcttcgtgtccctg
gagctgcgcgtaacagcagcctcctcgggagctccacgctaccgccgtgtcatccagatc
aacgaagtggtgctcctggaccccccagcagagctggaagcacggcgggcggacaagggc
ggccacgtggtactgcgctggctcccaccgcctggggcccctatggctagccttatccgc
tacgaggtgaacatctctgcaggcagcgcagcagggggagcgcagagggtagagatcctg
gatggccgcacagagtgcgtgctgagcaacctgcggggccgaacgcgttacacctttatg
gtacgcgcgcgtatggccgagccgagcttcgatggcttttggagcgcctggtcggaacct
gcgtcgctgctgaccgctagtgacttggaccccctcatcctgacgctctctctcatcctc
gtgctcatcctactgctgctggccgtgctcgccctgctctcccaccgccggactctgaag
cagaagatctggcctggcatcccaagccctgagagtgagtttgagggcctcttcaccacc
caccagggtaacttccagctgtggctgtaccagaacaacagctgtctgtggaacccctgc
accccattcacagaggacccacccgcccccctggaagtcctctctgaacgctgctggggg
gtgacacaagcaatagagcgaggagcagatgatgaggggcccctgctgaagccagtgggc
aatgagcatgccaaggagacctacctggtgctggacaagtggttactgccccagagccca
cccagtgaggaccccccaaggcctggtggcaatttggacatagcagccttggatgaaggc
tcagaagcgtcctcctgctcatcagctttggccctaaaaccagaaggggcctcggctgcc
agctttgagtacaccgtcctggaccccagctcccagctcttgcgcccaagggcactgcct
cctgagctgccccccaccccaccccacctaaagtacctgtaccttgttgtgtcggactct
ggcatctcaactgactacagctcaggggacttccagggagccaaggggggctcatccaat
ggcccctactccaacccttatgagaacagccttgtcccagcccccaagcctacaccccgc
cacctacacagcctgcacctaggactctag

KEGG   Pteropus alecto (black flying fox): 102887643
Entry
102887643         CDS       T02993                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04072  Phospholipase D signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04810  Regulation of actin cytoskeleton
pale05165  Human papillomavirus infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102887643 (PDGFRB)
   04014 Ras signaling pathway
    102887643 (PDGFRB)
   04015 Rap1 signaling pathway
    102887643 (PDGFRB)
   04630 JAK-STAT signaling pathway
    102887643 (PDGFRB)
   04020 Calcium signaling pathway
    102887643 (PDGFRB)
   04072 Phospholipase D signaling pathway
    102887643 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    102887643 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102887643 (PDGFRB)
   04540 Gap junction
    102887643 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102887643 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102887643 (PDGFRB)
   05206 MicroRNAs in cancer
    102887643 (PDGFRB)
   05230 Central carbon metabolism in cancer
    102887643 (PDGFRB)
   05231 Choline metabolism in cancer
    102887643 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    102887643 (PDGFRB)
   05218 Melanoma
    102887643 (PDGFRB)
   05215 Prostate cancer
    102887643 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102887643 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102887643 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102887643 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pale04090]
    102887643 (PDGFRB)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102887643 (PDGFRB)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102887643 (PDGFRB)
CD molecules [BR:pale04090]
 Proteins
  102887643 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set C2-set_2 Ig_6
Other DBs
NCBI-GeneID: 102887643
NCBI-ProteinID: XP_006906456
LinkDB
Position
Unknown
AA seq 1110 aa
MLLLSAMPAPVLKGQVLLLPLLLLLGPQVSQGLVITPSEPEIILNVSSTFVLTCSGPAPV
MWKRMMPKQLPQELTETQDGNFSSILTLTNVNGSDTGEYFCTYNDSHGLEDGEQKRLYIF
VPDPNMGFLPVYPEEVFIFLTEVTEITIPCRVTDPQLVVTLHEKKVDVPLPFPYDHQRGF
SGTFEDKTYVCKTIIGDKEVDSEAYYVYSLQASSINISMNAVQTVVRQGENITITCIVTG
NEVVNFEWIYPRKESGRLVEPVTDFDTPSHIRSILHIPSVELGDSGTYICNVSESVYDHG
DEKAINVTVVESGYVHLLEELDAVQFAELHRSRTLQVVFEAYPPPTVMWLKDNHTLGDSS
AGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEAQLSFQLQINVPARVLE
LSESHPANGEQTVRCRGRGMPQPHLTWSTCGDLKRCPRELSPTPLGNSSEESQLETNVTY
WAEEQEFEVVSMLRLSHVDQPLSVRCTLRNLLGHDVQEVTLVPQSSPFKVVVISAILALV
VLTIISFFILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVL
GRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHL
NVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHCSDKGRRASAELYSNALPV
GLPLPSHMSLPGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSNYMAPYDNYVPSA
PERTCRATLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKI
CDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGT
PYPELPMNEQFYNAIKRGYRMAQPAHASDEIYKIMQKCWEEKFEIRPPFSQLVLLLERLL
GEGYKKKYQQVDEEFLRSDHPAVLRSQARLPGFHGLRSPLHTSSVLYTAVQPNEGDNDYI
IPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEPQPEPQVEP
ELEPGPELEQEWPPDSSCPGPRAEAEESFL
NT seq 3333 nt   +upstreamnt  +downstreamnt
atgctgcttctgagtgccatgccagctcctgtcctcaaaggccaggtgctgttgctgccc
ctgctgctgttgctgggaccacaggtctcccaaggtctggtcatcacaccctcagagcca
gagatcatcctcaatgtctccagcaccttcgttctgacctgctcgggtccagctccagtg
atgtggaaacggatgatgcccaagcagctcccgcaagaactgactgagactcaggatggc
aacttctccagcatactgacgctgaccaatgtcaatgggtctgacacaggagaatacttt
tgtacctacaatgactcccatgggctggaggatggtgagcaaaagcggctctatatcttt
gtgccagatcccaacatgggctttctccctgtgtaccccgaggaagtgttcatctttctc
acggaagtaactgagatcacaattccatgccgagtgacagatccacaactggtggtgaca
ctgcatgagaagaaagtggatgtcccactgcctttcccctatgaccaccaacgtggcttc
tctgggacctttgaggacaagacctatgtctgcaaaaccatcatcggggacaaagaggtg
gattccgaagcctactatgtctacagcctccaggcgtcatccatcaacatctcaatgaat
gcagtgcagactgtggtccgccagggtgagaacatcaccatcacgtgcatcgtgactggg
aatgaggtggtcaactttgagtggatttacccccgcaaggagagtgggcggctggtggag
ccagtgaccgacttcgatacgccctctcacatacgctccatcctgcacatccccagtgtc
gagctgggtgactcagggacctatatctgcaatgtatcagagagtgtgtacgaccatgga
gatgaaaaggccatcaatgtcaccgtggttgagagtggctacgtgcatttgctggaggag
ctggacgctgtacaatttgcagagctgcaccggagccggacactgcaggtggtgttcgaa
gcctacccgccacccactgtcatgtggctcaaggacaaccatactctgggcgactccagc
gccggcgagatcgccctgtctacgcgcaatgtgtcggagactcggtacgtgtcagaactg
acattggtgcgggtgaaggtggctgaggctggtcactacaccatgagggccttccatgag
gacgctgaggcccaactctccttccagctgcaaattaacgtgcctgcccgggtgctggag
ctgagcgagagccaccctgccaacggggagcagacagtccgctgtcgtggccggggcatg
ccccagccacacctcacctggtctacctgcggtgacctcaaaaggtgtccgcgtgagctg
tcacccacgccactggggaacagttccgaggagagccagctggagacaaacgtaacgtac
tgggcagaggagcaggagtttgaggtggtgagcatgctgcgcctgagccatgtggatcag
ccgctgtctgtgcgctgcacgctgcgcaacctgctgggccatgacgtgcaggaagtcacc
ctggtgccacagtcctcgcccttcaaggtggtggtgatctcagccatcttggccttggta
gtcctcacaatcatctctttcttcatcctcattatgctctggcagaagaagccccgctat
gagatccgatggaaggtgattgaatccgtgagctcggatggccatgagtacatctatgtg
gaccctatgcagctgccctatgactccacctgggagctaccacgggaccagcttgtgctt
gggcgcaccctcggttccggggcctttgggcaggtggtggaagccacagctcatggcctg
agccattctcaggccacaatgaaagtggctgtcaagatgctgaaatccactgcccgcagc
agtgagaagcaagcccttatgtcggagctgaagatcatgagtcacctcgggccccacctg
aacgtggtcaacctgcttggggcttgcaccaaaggagggcccatctacatcatcactgag
tactgccgctacggcgacctggtggactacctgcaccgcaacaagcataccttcctgcag
cactgctccgacaagggccgccgggccagcgccgagctctacagcaacgcactgcctgtt
gggctccccctgcccagccatatgtccctgcctggggagagtgatggtggctacatggac
atgagcaaggatgagtcggtggactacgtgcccatgctggacatgaaaggggacatcaag
tatgcagacatcgagtcctctaactacatggctccttatgataactacgttccctccgct
cctgagaggacctgtcgagcaactttgatcaatgaatccccagtgctcagctacacggat
cttgtgggcttcagctatcaggtggccaatggcatggagttcctggcctccaagaattgt
gtccaccgagacctggcagccaggaatgtgctcatctgcgagggcaaactggtcaagatc
tgtgacttcggcctggctcgtgacatcatgagggattctaactacatctccaaaggcagc
accttcctgcccctgaagtggatggcccccgagagcatcttcaacagcctctacaccacc
ctgagtgacgtttggtcctttgggatcctactctgggagatcttcaccctgggtggcacc
ccttatccagagctgcccatgaacgagcagttctataatgccatcaaacggggttaccgc
atggcccagcctgctcatgcctccgacgagatctacaagatcatgcagaaatgctgggag
gagaagtttgagatccggccccctttctcccagctggtgctgcttctcgagagactgctg
ggtgagggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagcgaccac
ccagccgtcctgcggtcccaggcccgcctgcctggcttccatggcctgcgatcccccctg
cacaccagctcagtcctctacactgccgtgcagcccaacgagggtgacaacgactatatc
atccccctgcctgaccccaaacctgaggttgctgatgagggcccactggagggttcccct
agccttgccagctccaccctgaatgaagtcaacacctcctctaccatctcctgtgacagc
cccctggaaccccaagaggaaccagaaccagagccccagcctgagccccaggtggaaccg
gagctggagccagggccggagctggagcaggagtggccaccagattcaagctgccctggg
cctcgggccgaggcagaggagagcttcctgtag

KEGG   Pteropus alecto (black flying fox): 102888010
Entry
102888010         CDS       T02993                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04066  HIF-1 signaling pathway
pale04217  Necroptosis
pale04380  Osteoclast differentiation
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05164  Influenza A
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05200  Pathways in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102888010 (IFNGR1)
   04066 HIF-1 signaling pathway
    102888010 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102888010 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102888010 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102888010 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    102888010 (IFNGR1)
   04659 Th17 cell differentiation
    102888010 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102888010 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102888010 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102888010 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102888010 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102888010 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    102888010 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    102888010 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102888010 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102888010 (IFNGR1)
   05140 Leishmaniasis
    102888010 (IFNGR1)
   05142 Chagas disease
    102888010 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102888010 (IFNGR1)
   04090 CD molecules [BR:pale04090]
    102888010 (IFNGR1)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IFN receptor family
   102888010 (IFNGR1)
CD molecules [BR:pale04090]
 Proteins
  102888010 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind EphA2_TM
Other DBs
NCBI-GeneID: 102888010
NCBI-ProteinID: XP_006915443
LinkDB
Position
Unknown
AA seq 478 aa
MQSRMALFLLLVVITQATSRAEMSATDPELSSVPLPTNVNVKAHNLNTVVSWDYPMPQQT
LVFIVQVKIYGETTWIDACNTSDYYCNIFYKILDPSIPLWARVKARLGQKESAYVESKEF
ILCKQGEVGPPKLDIRQKEDHIIIDIYHPLVIVNEKELGVIYDEETTCYTFMYNVYVRIN
GSETTNRRYMQKEDDCNETQCHLSIPVSSLNSTYCIAAEGISDTWSVTTEKSRELCITIF
DHKSKENSFWIPIVAAFLVFVVVILLVVCFHIKKIHPCKKESIMLPKSLLSVVKNASFEA
KSESKYISPITYEPIVPEHEKVEEQLSPATISSSHIKDDPAKVEHREDFSSETEVVTIEE
NTPDTAPGSPLTPVKRDDSVHSSSNQSEPCSVALNSYHSRSGSDSGVAESDTFLSDSEFP
PNSKTEVKTGRQESTMLRNTTTSFGYDKPHVLVDLLVDEGGKESLIGYRVTADSKEFS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgcagagcagaatggctctcttcctccttctcgttgtcatcacgcaggccacgagcagg
gctgagatgagcgccacggatccggagctgtcctcggtgcctctaccaaccaatgttaac
gttaaggcccacaacttgaatactgtcgtatcttgggattacccaatgccacagcagacg
cttgtttttattgtccaggtaaagatctacggtgagacaacgtggattgatgcctgcaat
acctctgattattactgtaatatcttttacaagattcttgatccatcaattcctttatgg
gccagagttaaagctaggcttggacaaaaagaatcagcctatgtagagtccaaagaattt
attttgtgcaaacaaggggaagttggaccacctaaactggatatcagacagaaggaagac
catatcattattgatatatatcatcctttagttattgtaaatgaaaaagagctgggagtc
atatatgatgaagaaactacttgttatacattcatgtacaatgtgtatgtgagaataaat
ggaagtgagaccacaaatagaaggtacatgcagaaagaagatgattgcaatgagactcag
tgccatttaagtattccagtgtcctcactgaattctacgtactgtattgcagcagaagga
atctcagacacatggtctgtgacaactgaaaaatccagagaactttgtatcaccattttc
gaccataagagcaaagaaaattcattttggattccaattgttgctgctttcctagtcttt
gtagtagttatccttctagttgtatgttttcatattaagaagatacatccatgtaagaaa
gaaagcattatgttacccaagtccttgctgtctgtggtaaaaaatgcctctttcgaggca
aaatctgaatcaaaatatatatcgcccatcacctacgaacccattgttcctgaacatgag
aaggtggaagagcagttgtctccagcaacaatttcaagttcacatatcaaggacgatccg
gcaaaagtagagcacagagaagatttttctagtgaaacagaagtggtgaccatcgaagag
aatacccccgacacggctcctggtagccctctgaccccagtaaagagagacgattccgtc
cattcaagtagcaaccagtctgaaccctgcagcgtcgctttaaactcttatcactccaga
agtggttctgatagtggcgttgcagaatcggacactttcttatctgactcagaatttcct
ccaaatagtaaaactgaagtaaagacaggaagacaggagtccacaatgctcagaaacact
accacctcctttggttacgataaaccacacgtgttagtggatctgcttgtagacgaaggt
ggtaaagagtccttgattggttatagagtcacagcagattccaaagagttttcataa

KEGG   Pteropus alecto (black flying fox): 102888070
Entry
102888070         CDS       T02993                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04144  Endocytosis
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05321  Inflammatory bowel disease
pale05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102888070 (IL2RG)
   04151 PI3K-Akt signaling pathway
    102888070 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102888070 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102888070 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102888070 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102888070 (IL2RG)
   04659 Th17 cell differentiation
    102888070 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102888070 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102888070 (IL2RG)
   05340 Primary immunodeficiency
    102888070 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102888070 (IL2RG)
   05162 Measles
    102888070 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102888070 (IL2RG)
   04090 CD molecules [BR:pale04090]
    102888070 (IL2RG)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL2 receptor family
   102888070 (IL2RG)
CD molecules [BR:pale04090]
 Proteins
  102888070 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 102888070
NCBI-ProteinID: XP_006908592
LinkDB
Position
Unknown
AA seq 354 aa
MLKSPSPLRSLLLLQLPLLGVGLTTMVLAPSGNEDITADAFPTSPPAGAIGVSTVPLPEV
QCFVFNVEYMNCTWNSSSELQPTNLTLHYWYENLDHDKIKECGHYLFSSEITSGCWLQKE
EIRLYHTFVVQLQDPQEPRRHTVQKLKLQDLVIPWAPENLTVHKLSESQLELNWNNTYLD
KCLEHLVQYRSDRDRSWTEQSVEHRQSFSLPSVDAQKFYTFRVRSRHNPLCGSAQQWSEW
SRPVHWGSRASKENPLLFALKAMLIPLGSMGLIVSLICVYCWLERTMPRIPTLKNLEDLV
TEYQGNFLAWSGVSKGFAESLQPDYSERLCHVSEIPPKAGALGEGPGGSPTLHP
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgttgaagtcaccatcgccactcagatccctcttactcctgcagctgcctctgctgggg
gtggggctgaccacaatggtcctcgcgcccagtgggaatgaagacatcacagctgatgcc
ttcccgacctctccacccgccggggccatcggcgtgagcaccgtgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaactgcacttggaacagcagctcggagctc
cagcccaccaacctgactctgcactattggtacgagaacttggatcatgacaaaatcaag
gagtgtggccactacctattctcctcggagatcacttccggctgttggttgcaaaaagag
gagatccgtctataccatacatttgttgtccagctccaggacccgcaggaacctaggagg
cacaccgtgcagaagttaaagctgcaggatctggtgatcccctgggctcccgagaaccta
accgttcacaaactgagcgaatcccagctagaactgaactggaacaacacgtacttggac
aaatgcttggagcacctggtgcaataccgcagcgaccgagaccgcagctggactgaacaa
tccgtggagcacagacagagcttctccctgcccagtgtggacgcacagaaattctacacg
ttccgtgttcggagccgccataacccgctctgtggtagcgcccagcaatggagtgaatgg
agccgcccagtgcactggggcagccgcgcttcaaaggagaaccccttgctgtttgcactg
aaggccatgctcatcccccttggctccatgggactgatcgtcagcctcatctgtgtgtac
tgctggctggaacggacgatgccccgaattcctaccctcaagaacctggaggatctggtt
accgaataccaggggaactttttggcctggagcggtgtgtccaagggttttgccgagagc
ctgcagccagactacagtgaacggctctgccacgtcagtgagattccccccaaagcgggg
gccctaggggaggggcctgggggctcccccacgttacacccttaa

KEGG   Pteropus alecto (black flying fox): 102888258
Entry
102888258         CDS       T02993                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin-20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102888258 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102888258 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102888258 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102888258 (IL20RA)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL10/28 receptor family
   102888258 (IL20RA)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 102888258
NCBI-ProteinID: XP_015447583
LinkDB
Position
Unknown
AA seq 501 aa
MKNILQWRPPEGLLGVEVTYTVLYFIYGQKKWLNKSECRNISRTYCDLSAETSDYEHQYY
GKVKAIWGTNCSKWAETGRFYPFLETQIGPPAVALTPGEKSISIVLTAPEKWKKNPEESS
ISMQQIYSNLKYNVSVYNTKSNRTWSLCVTNHTLMLSWLEPDTLYCIQVESFVPGPPRLA
QPSEKQCVNTLKDQTSALKIKIIFWYVLPTSVIVFIFFVMGFSMYRYIHVGKEKHPANLI
LIYGNEFDKRFFVPAEKIVINFITLNILEDSKISHKDISVMEKNNDASDLNEPSEDQEPQ
QEEMEVKRLGYASHLMDIFCDSEKYTKGSSLTQQESLSGTTPTARTVIEYEYDVRTTDIC
VGPGDQALSLQEVFLQGKLFEQQAALAVTDPQTLLYSYTPQLRDLDHQPQEYVDVEEGPE
EELSTTLVDWDPQTGRLCIPSLSSFEHDSEDCEFPEYKELTEEGLLSRLYEKQALDKSLE
EDETYLLQFLEEWGLYVQMED
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaagaatatcttacaatggagaccaccagagggcctactaggagtggaagttacttac
accgtgctgtatttcatatatgggcaaaagaaatggctgaataaatctgaatgcagaaac
atcagtaggacctactgtgatctctctgctgaaacttctgactatgaacatcaatattat
gggaaagttaaggccatttggggaacgaattgttccaaatgggcagaaactggacgattc
tatccttttttagaaacacagattggccctccagcggtggctttgactcctggtgagaaa
tccatttctattgttctaacggctccagagaagtggaagaaaaatccagaagaaagttct
atttccatgcaacaaatatactctaatctgaagtataatgtgtccgtatataatactaaa
tcaaacagaacgtggtccctgtgtgtgaccaaccacacacttatgctcagctggctggag
ccggacacgctgtactgcatccaggtggagtcgttcgtcccagggccacctcgccttgct
cagccttccgagaagcagtgtgtcaatactttgaaagatcaaacatcagcactgaagatt
aaaatcatcttctggtatgttttgcccacatctgttatcgtgtttattttttttgtgatg
ggcttctccatgtacagatatatccatgttggcaaagagaaacacccagcaaatttgatt
ttgatttatggaaatgaatttgacaaaagattctttgtacctgctgaaaaaattgtgatt
aactttatcaccctcaatattttggaggattctaaaatttctcataaggatataagtgta
atggaaaaaaacaatgatgcctcagacctgaatgagcccagcgaggaccaggagccccag
caggaagaaatggaggtgaagcgcttaggatatgcttcacatctgatggacattttctgt
gactctgagaaatacaccaaagggtcttccctaacccagcaagagtcactcagcggaaca
acacccacagctagaacagtcattgaatatgaatatgatgtaagaactactgacatttgt
gtggggcctggagatcaggcgctcagtctgcaggaggtgttcctccaaggaaaattattt
gagcaacaagcagctttggcagtcacagatccacaaacactactgtattcatatacccct
cagctcagagacttagaccaccagccacaggagtacgtggacgtggaagaagggccagag
gaagaactatcaactacacttgtcgattgggaccctcagactggcaggctgtgtatacct
tcattatctagctttgaacatgactcagaagactgtgagtttcctgagtacaaggagctc
acagaagagggccttttgtctagactctatgagaaacaggctctagacaagtcactggaa
gaagatgaaacctatcttttgcaatttttggaggaatggggattatatgtacaaatggaa
gactaa

KEGG   Pteropus alecto (black flying fox): 102889092
Entry
102889092         CDS       T02993                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04068  FoxO signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
pale05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889092 (IL7R)
   04068 FoxO signaling pathway
    102889092 (IL7R)
   04151 PI3K-Akt signaling pathway
    102889092 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889092 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102889092 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102889092 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    102889092 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102889092 (IL7R)
   04090 CD molecules [BR:pale04090]
    102889092 (IL7R)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL2 receptor family
   102889092 (IL7R)
CD molecules [BR:pale04090]
 Proteins
  102889092 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 Pur_ac_phosph_N PTP_tm
Other DBs
NCBI-GeneID: 102889092
NCBI-ProteinID: XP_006917863
UniProt: L5K796
LinkDB
Position
Unknown
AA seq 459 aa
MTILGTAFGMVFYLLQVVSGESGYAQNGDFEDAELDDYSFSCYSQLEVNGSQHLLNCTFD
DPDVNSTDLEFEICEALVGVNCLNFSKHQEMYLIKTNKFLLIGDSKICVKLGGKIVTCRK
MKIVNIVKPEAPFDIRVIYRKEANDFVVTFNTSHLQKNYVKKLIHEVAYRQEKNENDWMR
VNLSSTKLTLLQRKLQPDAKYEIKVRSIPNTDYFKGFWSEWSPSFHFRTPETKGSEEMDP
VLLIVSVLSFFSVALIVILACVLWKKRIKPIIWPSLPDHKKTLEQLCKKPKKNLNASFSP
ESFLDCQIHKVDGIQARDEVEGFLQDAFAPQPAEPEKQRPGAGGQGSSWMSEQAVKTSQT
FRGDAPLRCQAGDVSACDPPVLSSSRFPDCREGDEKGPHAYQGLLLGPGTTNDTVSPPFP
FQSEILTLTPAMQAQPLLTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacagcttttggtatggttttctatttacttcaagttgtttctgga
gaaagtggctatgcacagaatggagactttgaagatgcagaactggacgactactcattc
tcctgctacagtcagttggaagtgaatggatcccagcacttgctaaactgtacttttgac
gaccccgatgtcaacagcaccgatctggaatttgaaatatgtgaggcccttgtgggtgta
aattgcctgaattttagtaaacaccaagagatgtatctcatcaagacaaataagttctta
ctgattggagacagcaaaatatgtgtgaagcttggaggaaagattgtaacttgcagaaaa
atgaagatagtcaatatagttaaacctgaggctccttttgacataagagtcatctatcgc
aaggaagcaaatgactttgtggtgacatttaatacatcgcacttgcaaaagaattatgta
aaaaaattaatacatgaggtagcctaccgccaggaaaaaaatgaaaatgactggatgcgc
gtgaatttatccagtacaaagctgacactcctacagagaaagctacaacctgatgcaaag
tatgagattaaagtccgatccatccctaataccgactattttaaaggcttctggagtgaa
tggagtccaagtttccacttcagaactccggagactaaaggctcagaggagatggatcca
gttctactaattgtcagcgttctgagtttcttctctgtggctctgatagtcatcttggcc
tgtgtgttatggaaaaaaagaattaagcctattatatggcccagtctccctgaccacaag
aagactctggagcaactgtgcaagaaaccaaaaaagaatctgaatgcgagtttcagtcct
gagagtttcctggactgccagattcataaggtggatggcattcaagccagagatgaagtg
gaaggctttctgcaagacgcatttgctccgcagccggcggagcctgagaagcagaggcct
ggagcgggtgggcagggctccagctggatgtctgagcaggcagtcaaaacctcccaaact
ttcagaggagatgcacccctcagatgccaggctggggacgtcagcgcgtgtgacccccct
gtgctctcctcctccaggttcccagactgcagggaaggtgacgagaaagggcctcacgcg
taccagggcttgctgcttggtcctggaactacaaatgataccgtatcccctccgtttcct
ttccaatcagaaatcctgacattgaccccagctatgcaggcacagcccctcctcacttcc
ttaggatcaaatcaagaagaagcgtatgtcaccatgtccagcttctaccaaaaccagtga

KEGG   Pteropus alecto (black flying fox): 102889724
Entry
102889724         CDS       T02993                                 

Gene name
IL13RA2
Definition
(RefSeq) interleukin-13 receptor subunit alpha-2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889724 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102889724 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102889724 (IL13RA2)
   04090 CD molecules [BR:pale04090]
    102889724 (IL13RA2)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL3 receptor family
   102889724 (IL13RA2)
CD molecules [BR:pale04090]
 Proteins
  102889724 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3 IL4Ra_N
Other DBs
NCBI-GeneID: 102889724
NCBI-ProteinID: XP_006910840
LinkDB
Position
Unknown
AA seq 387 aa
MAFIHLDIRCLYAILICTAFGSTLSSDAEIKVKPPQDFEIVDPGYLGFLYLQWQPSLSLD
NFKECTIEYELKYRNIDSENWKTIITKNLHYKDGFDLNKGVEAKIHTLLQGQCTNGSAVQ
SSWSEATYSTSPQGNLETKIRDMDCIYYNWEYLVCSWKLGMGVHFDTNYNLFYWYEGLDH
ALQCVDYIKSNGKNIGCRFPYLESPDYKDFYICVNGSSKSQLIRPSYFIFQLQDIVKPSP
PDYLSIIVKNSEEINLKWSIPIGPTPAKCFIYEIEFTEDDTTLVTPTFENEIYITRTSNK
SQQLCFLVRSRVNIYCSDGGIWSEWSDKQCWQGDIWRETLLFFLIPFAFVSLFVLLITCM
LLYKQKALLKMVFHTKKELFSHQETLF
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggctttcattcatttggatatcagatgtctatatgccattcttatttgcactgctttt
ggctctactttgtcttcagatgctgaaataaaagttaaaccccctcaggattttgagata
gtggatcctggatatttaggttttctctatttacaatggcaaccttcactgtctctggat
aattttaaggaatgcacaatagaatatgaattaaaatacagaaatattgatagtgaaaac
tggaagactatcattactaagaatctgcattataaagacgggtttgatcttaacaaaggc
gttgaagcaaagatacacacgcttctgcaagggcaatgcacaaacggatctgcagttcaa
agttcatggtcagaagctacttattcgacatcaccacaaggaaatctggaaactaaaatt
cgggatatggattgtatatattacaactgggaatatttagtctgctcttggaaacttggg
atgggtgtccactttgataccaattacaacttgttttactggtatgaaggcttggaccat
gcattacaatgtgttgattacatcaagagtaatggaaaaaatattggatgcaggtttccc
tatttggagtcaccagactataaagatttctacatctgtgttaatggatcatcaaaatcc
cagcttatcagacccagctatttcatttttcagcttcaagatatagttaaaccttcacca
ccagactatcttagtattattgtgaagaattcagaagaaattaacctgaaatggagcatt
cctataggacctactccagcaaagtgtttcatttatgaaattgagttcacagaagatgat
actactttggtgactcccacatttgaaaatgaaatatatatcacaagaacatcaaataaa
agccaacaattatgctttttagtgagaagcagagtgaatatttattgctcagatggtgga
atttggagtgaatggagtgataaacaatgctggcaaggtgacatatggagggaaaccttg
ttatttttcttgataccatttgcttttgtctcattatttgttttgttaataacttgtatg
cttttgtataagcaaaaagctttactgaaaatggtttttcatacaaaaaaagaactcttt
tctcatcaagagacacttttttga

KEGG   Pteropus alecto (black flying fox): 102890093
Entry
102890093         CDS       T02993                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04080  Neuroactive ligand-receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102890093 (PRLR)
   04151 PI3K-Akt signaling pathway
    102890093 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102890093 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    102890093 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102890093 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102890093 (PRLR)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  Prolactin receptor family
   102890093 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind IL6Ra-bind fn3 SMYLE_N
Other DBs
NCBI-GeneID: 102890093
NCBI-ProteinID: XP_006917867
LinkDB
Position
Unknown
AA seq 623 aa
MKENVTSTFVFILLLFLNTNLLNGQSPPGKPEIFKCRSPEKETFTCWWKPGADGGLPTNY
TLIYHKEGDTNTHECPDYKTGGPNSCYFNKKHTSIWTIYIITINATNQMGSSTSDPRYVD
VTYIVEPDPPVNLTLELKQPEDQKLYLWIKWFPPTLVDVRSGWLILQYEIRLKPEKATEW
ETHFAGQQTQFKILSLYPGQKYLVQVRCKPDHGFWSEWGPESSIQIPNDSTLKDTTVWIF
VAVLSAVICLIMVWAVALKGYSMVACILPPVPGPKIKGLDTHLLEKGKSEELLSALGCQD
FPPSSDYEDLLVEFLEVVDNEDQQLMPAHSKELPGQGMKPKQLDPDSDSGQGSCDSPSLL
SDKCEEPWGNPSTFHISESIEKPENPETKGTRIWDPQSTSLEGKISYFHASESKSTWPLL
QPPRQHNPKSSYHNGDGCELAMGTAGASAPLLDKTDKHALKSSETAETEGEEKVTEQREV
ESFHSKTDPDTVWLLPQEKTAFIAAKLLDYVEIHKINKDGALALLPKQKENSSHTEKPSA
PESSKEYTRVSGLTDNNILVLARGPHAQNRPLCEEPAIEAPPSLQQNPAEKDLAPCTATP
SSCRRQLGGLDYLDPACLKLSFQ
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgaaggagaatgtgacatccacatttgttttcattttgctactttttctcaacaccaat
cttctgaatggacagtcacctcctggaaaacctgagatctttaaatgtcgctctcctgaa
aaggaaacctttacctgctggtggaagcctggggcagatggaggacttcccaccaattac
acgctgatttaccacaaggaaggagatacaaacacccatgagtgtccagactacaaaacc
ggtggccccaactcctgttactttaacaagaagcacacctccatctggacaatatacatc
atcacaataaacgccacgaaccagatgggaagcagtacctcggatccacgttatgtggac
gtgacttacatcgttgaaccagaccctcctgtgaacctgactttggaattaaaacagcca
gaagaccaaaaattatatctgtggataaaatggtttccacccaccctggttgacgtaaga
tctggttggctcatactccaatatgaaattcgattaaagcctgagaaagcaactgagtgg
gagactcattttgctgggcagcaaactcagtttaagattctcagcttatatccaggacag
aaatatcttgttcaggttcgttgcaagccagaccatggattctggagtgagtggggccca
gagagctccatccagatacctaatgattccaccctgaaagataccaccgtgtggatcttt
gtggctgttctttctgctgtcatctgtttgattatggtctgggcagtggctttgaaaggc
tatagcatggtcgcctgcatccttccaccggttcctgggccaaaaataaaaggacttgat
actcatttgctggagaagggcaagtctgaagaactactgagcgccctggggtgccaagat
ttccctccctcttctgactatgaggatttgctggtggagtttttagaagtcgtcgacaat
gaggaccagcagctgatgccggcccactcaaaagaactcccaggtcaaggcatgaagccc
aaacagctggatcccgacagtgactctggccagggcagctgtgacagcccttcgcttttg
tccgacaagtgcgaggaaccctggggaaatccctccacattccacatctctgaaagcatt
gaaaagccagagaatcctgaaacaaagggtacccgcatctgggacccccagagcacaagc
ttggaaggcaaaatctcctatttccatgccagcgagtccaaatcaacatggcctttactg
cagccccccagacagcacaaccccaaatcttcttaccacaatggtgatgggtgtgagctg
gccatgggcacggcaggcgcatcggctcctttgttggacaaaacagacaagcatgcttta
aaatcctcagaaaccgctgagactgaaggggaggaaaaagtgactgagcagagagaggtg
gaaagtttccattccaagactgacccagacaccgtgtggctgctgccccaggagaaaacc
gcctttattgctgctaaactcttggattacgtggagattcacaagatcaacaaagatgga
gcactagcattgctcccaaaacagaaagagaacagcagccacacagagaagcccagcgct
cccgaatccagcaaggagtacaccagggtgtctgggctgacggacaacaacatcctggtg
ttggcacgaggtccccacgctcaaaaccggcctttgtgtgaagaaccggcgatcgaggct
ccaccttcccttcaacagaatccagctgagaaagacctggccccgtgcaccgcgacaccg
agcagctgcagacgccagctgggtgggctggattacctagatcccgcgtgtcttaagctc
tcctttcagtga

KEGG   Pteropus alecto (black flying fox): 102890810
Entry
102890810         CDS       T02993                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04630  JAK-STAT signaling pathway
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102890810 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102890810 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102890810 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102890810 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102890810 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102890810 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102890810 (IL10RA)
   04090 CD molecules [BR:pale04090]
    102890810 (IL10RA)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL10/28 receptor family
   102890810 (IL10RA)
CD molecules [BR:pale04090]
 Proteins
  102890810 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 102890810
NCBI-ProteinID: XP_024903242
LinkDB
Position
Unknown
AA seq 586 aa
MLPSLVMPLAALLSLRLGSPLILILFSPATELLSPPSVWFEAEFFRHILHWTPIPNQSER
TYYEVELLRYGMEPWKSIPSCNQTLLLSCDLTMATLDLYHNYGYRAKVRAVDGSRHSNWT
ITRTRFSIDEVNLTVGSIKLEMHDGIIFGKIQPPRPKMAPKNDTYESIFPYFREYEIAIR
KVPGHYKFTNKKVKHENFNFSIPGEVGEFCVKVKPSVGSRVNKGIWSEEECIVLSRQYFT
VTNLSIFFTFVLLLCGALAYHLVLQLYVRHRRKLPAVLVFEKSSPFSLIKQLPSPDTQDT
IHPLDEEAFSKVSPELRNSELHGSTDSGFGSAKPSLQTEEPQFLLPAPHPQTERTLGKRA
PLELENSCSSGSSNSTDSGICMQEPSLSLGTGPNWEQQVGSNSQGQDDSGIGLVQNSEAQ
PRDVQDGSSLGHVSPLEPEVTEEKDPAMVAFQGYLKQTRGTEERAAKADCLEEESSSTSD
LGLKYRMCLDAKNSWPPQALAKGYLKQNHPEMTLAPSKAPTGQWNQPTEEWSLLGLPSCG
DLGTSDWNFAHDLLPLDCVAALDGLLGSFDSDLVTPPLISSLHSND
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgctgccgagcctggtaatgccgctggcggcgctcctcagcctgcgcctcggctcccct
ctgatactaatacttttctctccagcaacagaactgctcagccctccatctgtgtggttt
gaagcagagtttttccgccacatcctccactggacacccatcccaaatcagtctgaaagg
acctactatgaagtggagctcctgaggtatggcatggagccctggaagtctatccccagc
tgtaatcagaccctgctgctgtcctgtgatctcaccatggcaaccctagacctataccat
aactacggttaccgagccaaagtccgggcagtggacggaagccggcactctaactggact
atcacgagaacccgcttctccatagatgaagtgaatctgacagttggcagcatcaagcta
gagatgcacgatggcatcatcttcggaaagatccagccccccaggcccaagatggcccct
aaaaacgacacatatgaaagcatcttcccatacttccgcgagtatgagattgcaattcga
aaagtaccaggacactacaagttcacaaacaagaaggtaaaacatgaaaacttcaacttc
tccatccccggagaggtgggagagttctgtgtcaaggtgaaaccttctgtgggctcccga
gtgaacaaggggatatggtccgaggaggagtgcatcgtgctgtctcggcagtatttcacc
gtgactaacctcagcatcttcttcacctttgtcctgctgctctgtggagccctggcctat
cacttggtcctccagctatatgtgcggcaccggagaaagctgcctgccgtcctggtcttt
gagaagtctagtcctttcagtctcatcaaacagcttcccagcccagacacccaagacacc
atccatccccttgatgaggaggccttctccaaggtgtccccagagcttagaaactcagag
ctgcatggcagcacggacagtggctttggcagtgccaagccatcactgcaaactgaagag
cctcagttcctcctccctgctccccacccccaaactgagcggactctgggaaagagggca
cccctggagctggagaacagctgcagtagtggcagcagcaacagcacagacagcgggatc
tgcatgcaggagcccagcctgagtcttggcacaggacccaactgggagcagcaggtgggg
agcaatagccagggccaggatgacagtggcattggcctagtccagaactctgaggcgcag
cccagggatgtacaagatggctcatccttgggccatgtcagtcccttggagcctgaagtg
actgaagaaaaagacccagccatggtggcatttcagggctacctaaaacagacgagaggc
acagaggagagggcagccaaggcagactgcctggaggaagagtcctcctcaacaagtgac
cttggcctcaaatacagaatgtgcctggatgccaagaacagctggcctccacaagccctg
gccaagggctatttgaaacagaatcacccagaaatgactcttgctccctcaaaggcccca
actggacagtggaaccaaccaactgaagaatggtcacttctgggcttacccagctgtggt
gacctaggaacatctgactggaactttgcccatgatcttctccctctggactgtgtggca
gccctggatggtctcctgggcagctttgactcagacctggtcaccccgccactgatctcc
agtctgcactcaaatgactga

KEGG   Pteropus alecto (black flying fox): 102891485
Entry
102891485         CDS       T02993                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X1
  KO
K05131  interferon receptor 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04217  Necroptosis
pale04380  Osteoclast differentiation
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale05160  Hepatitis C
pale05162  Measles
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102891485 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    102891485 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102891485 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102891485 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102891485 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    102891485 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    102891485 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102891485 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891485 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102891485 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    102891485 (IFNAR2)
   05164 Influenza A
    102891485 (IFNAR2)
   05162 Measles
    102891485 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    102891485 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102891485 (IFNAR2)
   05169 Epstein-Barr virus infection
    102891485 (IFNAR2)
   05165 Human papillomavirus infection
    102891485 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102891485 (IFNAR2)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IFN receptor family
   102891485 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 102891485
NCBI-ProteinID: XP_006921037
UniProt: L5JZK1
LinkDB
Position
Unknown
AA seq 542 aa
MKISSEENIRCDRQERTYKITKMLLSQNASLIRPLNLYLMVYISLVFGTLQALPDVSDEP
CIFEITLRNFRTILSWKLKDHSIVPTHYTLQYAIMSGPEDVITVKDCTNITRSFCDLTDA
WVNMSETYTPRVVGHRGNRTLVDCEGSLFPLMDMPLEPPNFEIAGFTDHINVTVEFPPVL
PKIVYSEGSSFYLSLVIEEKSGNIVKKHKPKINADIAGNFIYVINELIPNTNYCISVYFE
PSNLGTINRSPVKCTRLQPEQESEPSESAKIGALITLFLIAAVIMSTIVTLKRIGYICLR
NEFPKMLKFDNFSAWIFPELPPLELVTVLEVIPINRKKKVWDYNYDESDSDDEAATRTSA
GGYTMHGLTGRTLCPASTSSATLEGCSDPDAPDTPDAEETDSPEPEAESESLMAPGPESE
CTCENAYERRETVLTDLFSEEDSSSTKGSRDKTIFNVDLNSVFMRVLDDDSEVPPVLSLP
EETVDLEDPEEMETSLLVASGEGSQPSFPSPSVESRWREDTPSEKSDTSKSDVDTGDGYI
MR
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgaaaatcagctccgaagaaaacatccgatgtgaccgtcaagaaaggacttataaaata
acaaagatgcttttgagccagaatgcctctttgattagaccacttaatttgtatctcatg
gtgtacattagcctcgtgtttggtactttgcaagctttgcctgatgtttcagatgagcct
tgcattttcgagataacgttaagaaatttccggacaattttatcgtggaaattaaaagac
cactccattgtaccaactcactatacattacagtatgcaatcatgagtggaccagaagat
gtcattactgtgaaggactgtaccaatatcacaaggtcattctgtgacctgacagatgcg
tgggtgaacatgtctgagacgtacactcccagagtagtcggacaccgagggaacaggacg
ctggtcgactgtgagggcagcttattcccgttaatggatatgcctttggaaccgccaaat
tttgagattgctggtttcaccgaccacattaatgtgacagtggagtttccacccgtcctg
cccaagatagtgtatagcgaaggatcatcgttttacttgtcacttgtcatcgaagagaag
tcagggaacattgttaagaagcataaacccaaaatcaatgcagacatcgctgggaatttc
atttatgtcatcaatgagctaattccaaacacaaactactgtatatctgtttattttgag
ccttccaatctgggaacaataaatagatcgcctgtaaaatgtacccgtcttcaacccgaa
caggaatcagagccatcagaatctgccaaaataggagcattgattactctgtttttgata
gcagctgtcatcatgagcaccatagtaacactgaaacggatcggttatatatgcttaaga
aatgagttccccaaaatgttgaagtttgataacttctcagcctggatatttcctgagctg
ccaccgttggaactggtaaccgtgttggaggtcattcccatcaacagaaagaagaaagta
tgggattataactatgatgaaagtgacagcgatgacgaagcagccacccgaacaagtgca
ggaggctataccatgcacggactaacaggcaggactctgtgtccggcctccacctcttct
gccaccttggagggctgcagcgacccagacgccccagacaccccagacgccgaggaaact
gactcgcccgagcctgaggctgaatctgagtctctgatggcaccaggacctgagtcagaa
tgcacatgtgagaatgcctacgagaggagagagactgtgctgacggacctcttttcagag
gaggacagcagctccactaagggatccagggacaaaactatcttcaatgtggatttaaat
tctgtgtttatgagggtcctcgacgacgactcagaagtccctccagtgttatctcttcca
gaagagacagtcgacctagaggatcccgaagaaatggaaacaagccttctggtggccagt
ggagaagggtcacaaccatccttccccagcccctctgtggagtccaggtggcgtgaagat
actccttctgaaaaaagtgacacttccaagtctgatgttgacactggggatggttatata
atgagatga

KEGG   Pteropus alecto (black flying fox): 102891511
Entry
102891511         CDS       T02993                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04144  Endocytosis
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102891511 (IL2RA)
   04151 PI3K-Akt signaling pathway
    102891511 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102891511 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102891511 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102891511 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102891511 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    102891511 (IL2RA)
   04659 Th17 cell differentiation
    102891511 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891511 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102891511 (IL2RA)
   05162 Measles
    102891511 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102891511 (IL2RA)
   04090 CD molecules [BR:pale04090]
    102891511 (IL2RA)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL2 receptor family
   102891511 (IL2RA)
CD molecules [BR:pale04090]
 Proteins
  102891511 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 102891511
NCBI-ProteinID: XP_006907010
LinkDB
Position
Unknown
AA seq 267 aa
MEPGLLMWRFLTLILVTEGVTEFCPHSLPDVRNATFEALTYKVGTLLNCGCKRGFRRISN
GAAFMNCTGDPGHPSWGNQCQCVRNSRGNSEKQVPPKPEEQKERKPTDMQSQLQPTNQAT
LPGHCRKPPPWDHEDSERIYHFVVGQTVHYKCAPGFRALQRGPATSVCKMACGMTKWTQP
QIRCMKARQDGQLPGDEELEASTDTPEHETSCPFVTTATTDFQKQTEVAATVEPFIFTTE
YQIAVACCAFLLVSTLLLSGLAWQRRR
NT seq 804 nt   +upstreamnt  +downstreamnt
atggaaccaggcttactgatgtggagattcctcacactcattctggtaacagaaggcgtg
acagagttttgtcctcacagcctaccagatgtcagaaatgccacgttcgaggccctcacc
tacaaggtgggcacgctgctaaactgtggatgcaagagaggcttccgcagaataagcaat
ggggcggcctttatgaactgtacgggggaccccggccacccttcctggggaaaccagtgt
caatgcgtgaggaattcccgtgggaacagtgaaaagcaagttcctcccaaacccgaagaa
cagaaggaaagaaaacctacggatatgcagagccaactgcagcccacgaaccaagctacc
cttccaggccactgcaggaagcctccgccatgggaccacgaagattcggagagaatctac
catttcgtggtggggcagacagtacactacaagtgtgccccgggattcagggccctgcag
agaggtcctgccacgagcgtctgcaaaatggcatgcgggatgacgaagtggacgcagccc
cagatcaggtgcatgaaggcaaggcaggacggccagctgccaggtgacgaagagctcgaa
gcaagcacggatactcctgagcatgagacttcctgtcccttcgtaacgacagccactaca
gattttcaaaaacaaacagaagtggctgcgaccgtggagccgttcatattcaccaccgag
taccagatagcagtggcctgctgcgccttcctgctggtcagcaccctcctcctgagcggg
ctcgcctggcagcggagacggtga

KEGG   Pteropus alecto (black flying fox): 102891638
Entry
102891638         CDS       T02993                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04080  Neuroactive ligand-receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102891638 (GHR)
   04151 PI3K-Akt signaling pathway
    102891638 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102891638 (GHR)
   04060 Cytokine-cytokine receptor interaction
    102891638 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102891638 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102891638 (GHR)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  Prolactin receptor family
   102891638 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 DUF4605
Other DBs
NCBI-GeneID: 102891638
NCBI-ProteinID: XP_024907928
LinkDB
Position
Unknown
AA seq 614 aa
MDLWKLLLTLLVVGLSDAFSGNEDSSGTPKFTKCRSPELETFSCYWTDGVHHSLKSPGLV
QLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFS
VEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEINET
QWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPLACEED
FRFPWFLIIIFGIFGLTVILFLFIFSKQQRIKMLILPPVPVPKIKGIDPDLFKEGKLEEV
NTILAIHDNYKPEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNDHQKSLNILGAKDD
DSGRTSCYEPDILETDFNASEVGDGTSEVAQPQRLKGEADLLCLDMKNQNNPPCNDATPA
TQEPSVILAEENKPRPLIGGTESTHQASHTQLSNPSSLANIDFYAQVSDITPAGSVVLSP
GQKNKAGISQSDMHPDVVSFCQANFIMDNAYFCEADAKKCIAVAPHVEVESRVEPRFNQE
DIYITTESLTTTVGRSGTERAPSSEIPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSS
CGYVSTDHLNKIMP
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggatctctggaagctgctgttgaccttgctagtggtgggcttaagtgatgctttttcc
gggaatgaagattcttccgggacacctaaattcaccaagtgccgttcacctgaactagag
actttttcatgctactggacggatggggttcatcacagtttaaagagtccaggattggta
caactgttctatattagaaggagcactcaagaatggactcaagaatggaaagaatgccct
gactatgtctctgctggagaaaacagctgttactttaattcatcttatacctccatttgg
ataccctactgtatcaagctaactagcaatggtggtactgtggatcaaaagtgcttttcc
gttgaggaaatagtacaaccagatcctcccattggcctcaactggactttactgaacatc
agtttaacggggattcatgcggatatccaagtgagatgggaaccaccacccaatgcggat
gttcagaagggatggatagtcctggagtatgaactgcaatacaaagaaataaatgagacc
cagtggaagatgatggaccctgtattgtcaacatcagttccagtgtactcgttgagactg
gataaagagtatgaagtgcgcgtgagatccaggcaacgaaactctgaaaaatatggcgag
ttcagtgaggtgctctacgtaacacttccgcagatgagcccattggcatgtgaagaagat
ttccggtttccatggttcttaattattatctttggaatatttgggctaacggtgatatta
tttttattcatattttctaaacagcaaaggattaagatgctgattctgcccccagttcca
gttccaaagattaaaggaattgatccagatctcttcaaggaaggaaaattagaagaggtg
aacacaatcttagccattcatgacaactataaacctgaattctacaatgatgactcttgg
gttgaattcattgagctagatattgatgaccccgatgaaaagactgaaggatcagataca
gacagacttctaagcaatgaccatcagaaatcgcttaatatccttggggcgaaggacgat
gactctggacgtaccagctgttatgaacctgatattctagagactgatttcaatgccagt
gaggtgggtgatggtacctcagaggttgctcagccacaaaggttaaaaggggaagcagat
ctcttgtgccttgacatgaagaatcaaaataacccaccatgtaatgatgctacccctgct
actcaggagcccagtgttatcctagcagaggaaaacaaaccaagaccacttattggtgga
actgaatcaactcatcaagcttcccatactcagctaagcaatccgagttcactggcaaac
atcgacttttatgcccaggtaagcgacattacaccagcagggagtgtggtcctatccccg
ggacaaaagaataaggcagggatatcccagagtgacatgcatccagacgtggtctcattc
tgccaagcaaacttcatcatggacaacgcctacttctgtgaggcagatgccaaaaagtgc
atcgctgtggcccctcacgtcgaagtcgaatcacgtgtagagccaagatttaaccaggaa
gacatttacatcaccacagaaagccttaccactactgttgggaggtctgggacagaacgg
gctccaagttctgagatacctgtcccagactatacttccattcatatagtacaatctccg
cagggcctcgtgctcaatgcgactgccttgcccttgcctgacaaagagtttctctcatca
tgtggctatgtgagcacagaccacctgaacaaaatcatgccgtag

KEGG   Pteropus alecto (black flying fox): 102892040
Entry
102892040         CDS       T02993                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04217  Necroptosis
pale04380  Osteoclast differentiation
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102892040 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    102892040 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102892040 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102892040 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102892040 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    102892040 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    102892040 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102892040 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102892040 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102892040 (IFNAR1)
   05160 Hepatitis C
    102892040 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    102892040 (IFNAR1)
   05164 Influenza A
    102892040 (IFNAR1)
   05162 Measles
    102892040 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    102892040 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102892040 (IFNAR1)
   05169 Epstein-Barr virus infection
    102892040 (IFNAR1)
   05165 Human papillomavirus infection
    102892040 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102892040 (IFNAR1)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IFN receptor family
   102892040 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac PapD_N
Other DBs
NCBI-GeneID: 102892040
NCBI-ProteinID: XP_006921038
LinkDB
Position
Unknown
AA seq 575 aa
MAQDVTSEVGGAPRTMLDLLGVATLVLVAGMSWVLPAAAGETNLKSPQNVEVYIIDDTFI
LKWNQSDESVGNVTFSADYKTPGMDNWEKLPGCQNITSTKCDFSPLKINVFEELNLRIRA
EKGNNVSSWSIVDSFIPIKQAHIGPPEVHLDPEDKAIIVNISPPGTKNSTMWAMASTSFI
YSVVIWKKSSSVEDRTEIVIPGSKINKLSPETTYCLKVKAGLRSQRKVAFYSPAYCVNTT
VENKLPPPENIQISAENQVYVLKWNYTHENVTFQAQWLHAFMTKIPENYSGKWKQIPNCE
NVTTTQCVFPQNVFPKGIYFIRVKASDGNNTSFWSEEEKFDTDRQIVILPPVIDMKPINN
NSLRVCFGTPKGSQNKSVNQHFPLIYEIWFWENISNAESKIVKERADFTFPNLKPLTVYC
IKARALIETAKWNKSSVFSDTVCEKTKPGTTSKTWLITGICVAFLIPVVLYVVKVFLKFI
NYVFFPSSKPPSTIDECFSEQPLKNLFFSTSEEETERCFIIENIDTISVVEETNQIDENH
KIYNSQTSQDSGNYSNEDENSGSKTSEDFLQEETE
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggcccaggacgtgactagtgaggtcggtggcgccccgcggacgatgctcgacctccta
ggcgtggcgaccctagtgttggtcgccggcatgtcgtgggtgttgcccgcagccgcagga
gaaacaaacttaaaatctccccaaaatgtagaggtctacatcattgatgacacctttatc
ctgaagtggaaccagagcgatgagtctgtcgggaatgtgactttttcagcagattataaa
acgcctgggatggataattgggaaaaattacctgggtgtcaaaatattactagtacgaaa
tgcgacttttctccactcaagataaatgtttttgaagaacttaatttgcgtataagagca
gaaaaaggaaacaatgtgtcttcatggtctatagttgactcatttataccaattaaacaa
gctcacattggtcctccagaagtacatttagatcctgaagataaggcaataatagtaaac
atctctcctcctggaacaaaaaacagtaccatgtgggccatggctagtacaagctttata
tacagcgtagtcatctggaaaaagtcttcaagtgtagaagacaggactgaaattgttatt
cccggaagtaaaattaataaactctcaccagagacaacttactgtttaaaagttaaagca
ggactacgttcacagagaaaagttgctttttatagtccagcgtattgtgtaaatactaca
gttgaaaataaactgcctccaccagaaaacatacaaatcagtgccgaaaatcaggtctat
gttcttaagtggaattacacgcatgaaaacgtgacttttcaagctcagtggctccatgcc
tttatgacaaagattcctgagaactattcaggaaaatggaaacaaataccgaattgtgaa
aatgtcacaactacccagtgtgtctttccccaaaatgttttcccaaaaggaatttacttt
atccgtgtcaaagcatctgatggaaataacacatccttttggtctgaagaggaaaaattt
gatactgacagacaaattgtcatacttcctccagtcatcgacatgaagcccattaacaac
aactcgctgcgggtctgtttcggcaccccaaaaggctctcagaacaagtccgtgaaccag
catttcccactaatttatgaaatttggttttgggaaaacatttcaaatgctgagagtaaa
attgtaaaggaaagagctgattttacttttcccaacttgaaaccgctgactgtatattgt
atcaaagccagagcactgatcgagactgcaaagtggaataaaagcagtgttttcagtgat
actgtgtgcgagaaaacaaaaccaggaaccacttccaaaacctggcttataactggaatt
tgcgtcgcgtttttgatcccagttgttctttatgttgtgaaggtcttcttgaaatttatc
aattatgtgttctttccatcaagtaagcctccttccactatagacgagtgtttctccgaa
cagccgctaaagaatctatttttttccacttctgaggaagaaactgaaagatgttttata
attgaaaatatagacactatttctgtagtagaagaaactaatcaaattgatgaaaatcac
aaaatatataattcccaaaccagtcaagattcaggaaactattcgaatgaagacgaaaac
agtggaagtaaaacaagtgaagactttctacaggaggaaactgaatga

KEGG   Pteropus alecto (black flying fox): 102892156
Entry
102892156         CDS       T02993                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin-15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04672  Intestinal immune network for IgA production
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102892156 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102892156 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102892156 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102892156 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102892156 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102892156 (IL15RA)
   04090 CD molecules [BR:pale04090]
    102892156 (IL15RA)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL2 receptor family
   102892156 (IL15RA)
CD molecules [BR:pale04090]
 Proteins
  102892156 (IL15RA)
SSDB
Motif
Pfam: Sushi DUF1180
Other DBs
NCBI-GeneID: 102892156
NCBI-ProteinID: XP_015441077
LinkDB
Position
Unknown
AA seq 398 aa
MCRAVQAKLGSVPEKRRQGLGWSRAGRAELGGGSEAFGSPYGKAGTSSPGGCRGESAEAG
WENRLLWARLWVHGLGYRFVPGGLEDSTSSSCRPVLVWIGERSGIISELSPRTQVYRGIT
ARLKLHVFKVCDVTFRCRYTLRNDHRDRADEHIRHLTQSPLCVRAGTTCSTPTSIEHANI
RVKSYNENSRERYICNSGFKRKAGTSSLTKCLRNEDTNVTEWTIPSLKCVRDRSLTPQRP
PSTVAPARVTPEPDSPSPSGKEPAFSSKSDVAVATKQAVVPGAGLMPSEPPSAGGPGTVK
REPSQATPQTTAEVVGRTPTSSLDKPGARSYSFTDVTVAVPILVVVLFGATIVVIRVVRC
RQSRQTSWTPGVEMENIEGVPMTGGTDGRDDAENRHAV
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtgccgggctgtccaagcaaaactgggctcggtgcccgagaagcggcgccaagggctg
ggatggagtcgggctgggcgcgctgagctgggcggaggctcagaggcattcggatcccca
tacggaaaagcaggcaccagcagccccgggggatgcagaggggaaagcgctgaagcgggc
tgggaaaatcggctcctctgggcacgcctgtgggtgcacggtctggggtatcgctttgtg
cccggcgggttggaagactccaccagctcttcgtgccgtcccgtcctcgtctggatcgga
gagcggtcggggatcatcagtgaactttctccccgcacccaggtttatcggggcataact
gccagacttaaattgcatgtatttaaggtgtgcgacgtgacgtttcgatgcagatacaca
ttgcgtaatgatcaccgcgatcgagctgatgaacacatccgccacctcacgcagtcgcct
ctgtgcgtgagagcaggcaccacgtgctcgactcccacgtccatcgaacacgcaaacatc
cgggtcaagagttacaacgagaactccagggaacggtatatctgcaactctggtttcaag
cgtaaggctggtacgtccagcctgactaagtgcctgcgtaatgaggacacaaacgtgacc
gagtggacgatccccagtctcaagtgtgtcagagaccgctccctgactccccaaaggcca
ccctccacggtcgcaccggccagggtgaccccagagccagacagcccctccccttctgga
aaagagcccgctttctcttccaagtcggacgtcgcagtggccacaaagcaggccgtcgta
ccaggcgcggggctgatgccatcggagcctccttctgcaggaggcccagggaccgtgaag
agggagccctcccaagcaacaccccagacgacggcagaggtcgtggggcgcactcccacc
tcctccctcgacaagccaggtgcacgttcgtacagtttcaccgacgtcacggtggcagtc
cccatacttgtcgttgtgcttttcggagcaaccattgtggtcatccgtgtggtgcgttgc
agacaatcaaggcagacttcctggacgcccggtgttgaaatggaaaatatagaaggtgtg
ccaatgactggaggaaccgatggcagagacgacgcggagaaccgccacgccgtctag

KEGG   Pteropus alecto (black flying fox): 102892445
Entry
102892445         CDS       T02993                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha isoform X4
  KO
K05056  interleukin 11 receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102892445 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102892445 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102892445 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102892445 (IL11RA)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102892445 (IL11RA)
SSDB
Motif
Pfam: Ig_3 ig EpoR_lig-bind Ig_2
Other DBs
NCBI-GeneID: 102892445
NCBI-ProteinID: XP_006916095
LinkDB
Position
Unknown
AA seq 422 aa
MSSSCSGLSRVLVAVATALASASSSCPETWGSPGVQYGQPGRSMTLCCPGVTAGAPVSWF
RDHETSLLQGPDSGLGQELVLTQADSTDEGTYICRTLDGALGGMVTLQLGYPPARPLVSC
RAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGTDGQRMSPSTGPWPCPQDPPGAARC
VVHGAEFWSQYRINVTEVNPLGVSTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPVQHPAWSTVEPTGLEEVITDAVAGLPHAVRVSARDFLD
AGIWSAWSPEAWGTPSTEPLPKEIPAGSQPHTQPEEDTQVDSPAPPRPSLLPDLLPLDHR
DPLEQVAVLASLGIFSFLGLAAGALALGLWLRLRPDGKDGPQKPGFLAPMIPVDKLPGAP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgtggctacagccctggca
tctgcctcctcctcctgccccgagacctggggctccccaggagttcagtatgggcagcct
ggaaggtccatgacgctgtgttgcccaggagtgactgctggggccccagtgtcttggttt
cgggaccacgagacaagcctgctccagggacctgactctgggctagggcaagaactggtc
ctaacccaggcagacagcactgacgagggtacctacatctgccggaccctggatggtgca
cttgggggcatggtgaccctgcagctgggctaccccccagcccgccctcttgtctcttgc
cgagcagccgactatgagaacttctcctgcacttggagtcccagccaggtcagcggttta
cccacccgctacctcacctcctacagaaagaagacagtgccaggaactgatggccagagg
atgagtccatccacggggccctggccatgcccacaggatcccccaggggctgcccgctgt
gtggtccatggggcagagttctggagccagtaccggatcaatgtgactgaggtgaatccc
ctgggggtcagcacacgcctgctggatgtgagcttgcagagcatcttgcgtcctgaccca
ccccaggggcttcgggtagagtcagtacctggctacccccgtcgccttcgtgccagctgg
acatatcccgcctcctggccccgccaaccccacttcctgctcaagttccggctgcagtac
cgtccagtgcagcatcctgcctggtccacggtggagccgactggactggaggaggtgatc
acagacgcggtggctgggctgcctcatgctgtgcgggtcagtgcccgggactttctggat
gctggcatttggagtgcctggagccctgaggcctggggaactccaagcactgagccccta
ccaaaggaaataccagctgggagtcagccacacacacagccagaggaggacactcaggtg
gacagccctgctcccccaaggccctccctccttccagacctgctgccacttgaccatagg
gaccctctggagcaggtggctgtgctggcatctttgggaatcttctctttcctgggacta
gcagctggggccctggcactggggctctggctgaggctgagaccggatgggaaggatgga
ccccaaaaacctgggttcttggccccgatgattccagtggacaagcttccaggcgctcca
aacctgtag

KEGG   Pteropus alecto (black flying fox): 102893026
Entry
102893026         CDS       T02993                                 

Gene name
IL27RA
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102893026 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102893026 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102893026 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102893026 (IL27RA)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102893026 (IL27RA)
SSDB
Other DBs
NCBI-GeneID: 102893026
NCBI-ProteinID: XP_024907403
LinkDB
Position
Unknown
AA seq 595 aa
MRETRAAPCRPRPRPKLALLPLLVLLFHGTRPQGSPGPLQCYGVGPLGDLNCSWEPLRDL
GTPSTLHLQSLKYHSNRTWTVAVPTGQSWVTIPREQLTTSDELLVWGAEAGQPLWTPLEP
EQKSKPLNPVEIQGLELATGYEVSGRCRMEKEEDLWGEWSPILSFQTLPSAPKDVWISGN
PCGTQGGQKFLLLWKAPGHCVQLSYRVWFQVKGQELILEETPCCSSFIPTQVEWAAVSAV
NATSWDPLSNLSLVCLGPGSAPHGVVVSSIAGNTELLVTWQQGSGEPQEHVVDWAQDGDP
LEDLNWVRLPPGKLSALLPGNFEGGVPYRITVTAVSPGGLYSAPSVWWFREELAPLAGPV
LWRLQDAPPGTPAIAWGVVPRHQLRGHLTHYTLCAQSGTRPSVCMNVSGNTQNITLPNLP
WGPCELWMTASTIAGQGPPGPSLRLHLPDNTLKLKILPGVICLWGLLLIGCGVRLATPGR
CLHLWHKVLPRWVWEKVPDPANSNSSQPHMEEVPQAQPPRDLPILEVEDIEPLPVMEPPQ
ASSQLDSGYEKHFLPTPEELGLLGPPRRSHFWPEPTSGXEKGAYLTAEDTEDQKD
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcgggagacccgggctgccccctgccggccccggccaaggcccaagctggcgctgctg
cctctcctggtgctgctgttccacgggacacgtcctcagggcagccctgggcccctgcag
tgctatggagttggacccttgggcgacttgaactgctcgtgggagcctcttagggacctg
ggaacaccctccacgctgcatctccagagcctgaagtatcattccaacagaacctggact
gtggcagtgcccactgggcagagctgggtgaccatcccacgggaacagttaaccacatct
gatgaactccttgtctggggcgccgaggcggggcagcctctctggacccccctggaacca
gaacagaagtctaaacccctgaaccctgttgaaatccagggcctggagctagccactggc
tacgaggtgtctggccgctgccgaatggagaaagaagaggatctgtggggcgagtggagc
cccattctatccttccagacactgccttctgctccaaaagatgtatggatatcggggaat
ccctgtgggacacaaggtggacagaaattcctgcttctgtggaaggcccctgggcactgc
gtacaactgagctatagagtctggttccaggttaaaggtcaggagctgattctggaggag
actccctgctgtagttccttcatccccacccaggtggagtgggctgccgtgtctgctgtc
aatgccacaagctgggatcctctcagcaacctttctttggtctgcttgggtccaggctct
gccccccatggcgtggtggtcagcagcattgctgggaacacagagctgctggtgacttgg
caacaagggtctggggagccgcaggagcatgtggtggactgggctcaagatggcgacccc
ctggaggacctcaactgggtccgacttccccctgggaagctcagtgctctgttgccaggg
aatttcgaaggaggggtcccctaccgaatcacagtgacggcggtctctcctgggggcttg
tactctgccccctcagtctggtggttcagagaggaactagcacctttggcagggccagtg
ctttggcgactccaggatgcccccccagggactcccgccatagcgtggggagtagtccca
aggcaccaacttcggggccatctcacccactacaccttgtgtgcccagagtgggaccagg
ccttctgtctgcatgaacgtgagtggcaacacccagaatatcaccctgcccaaccttccc
tggggtccctgtgagctatggatgacagcgtccaccattgcaggacagggcccacctggt
cccagcctccggcttcacctaccagataacaccttgaagttgaaaatcctgccaggtgtc
atttgcctgtggggcctgctcctgataggctgtggtgtgagactagccacccctggcagg
tgcctccacctgtggcacaaggtactgccccgctgggtctgggagaaggtccccgatcct
gccaacagcaattccagccagccccacatggaggaggtgccccaggcccagcctcccaga
gacttgcccatcctggaagtagaggacattgagccactaccggttatggagcctccccag
gcttcctcccagcttgactctgggtacgagaaacacttcctgcccacgcctgaggagcta
ggccttttgggccccccacgcaggtcccatttctggcctgaaccaacctcaggttaggaa
aagggtgcttatttgacagctgaagacactgaggatcagaaagactaa

KEGG   Pteropus alecto (black flying fox): 102893495
Entry
102893495         CDS       T02993                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04072  Phospholipase D signaling pathway
pale04144  Endocytosis
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04520  Adherens junction
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04810  Regulation of actin cytoskeleton
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102893495 (EGFR)
   04012 ErbB signaling pathway
    102893495 (EGFR)
   04014 Ras signaling pathway
    102893495 (EGFR)
   04015 Rap1 signaling pathway
    102893495 (EGFR)
   04630 JAK-STAT signaling pathway
    102893495 (EGFR)
   04066 HIF-1 signaling pathway
    102893495 (EGFR)
   04068 FoxO signaling pathway
    102893495 (EGFR)
   04020 Calcium signaling pathway
    102893495 (EGFR)
   04072 Phospholipase D signaling pathway
    102893495 (EGFR)
   04151 PI3K-Akt signaling pathway
    102893495 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102893495 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102893495 (EGFR)
   04520 Adherens junction
    102893495 (EGFR)
   04540 Gap junction
    102893495 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102893495 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102893495 (EGFR)
   04915 Estrogen signaling pathway
    102893495 (EGFR)
   04921 Oxytocin signaling pathway
    102893495 (EGFR)
   04926 Relaxin signaling pathway
    102893495 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    102893495 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893495 (EGFR)
   05206 MicroRNAs in cancer
    102893495 (EGFR)
   05205 Proteoglycans in cancer
    102893495 (EGFR)
   05230 Central carbon metabolism in cancer
    102893495 (EGFR)
   05231 Choline metabolism in cancer
    102893495 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102893495 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102893495 (EGFR)
   05212 Pancreatic cancer
    102893495 (EGFR)
   05225 Hepatocellular carcinoma
    102893495 (EGFR)
   05226 Gastric cancer
    102893495 (EGFR)
   05214 Glioma
    102893495 (EGFR)
   05218 Melanoma
    102893495 (EGFR)
   05219 Bladder cancer
    102893495 (EGFR)
   05215 Prostate cancer
    102893495 (EGFR)
   05213 Endometrial cancer
    102893495 (EGFR)
   05224 Breast cancer
    102893495 (EGFR)
   05223 Non-small cell lung cancer
    102893495 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102893495 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102893495 (EGFR)
   05171 Coronavirus disease - COVID-19
    102893495 (EGFR)
   05163 Human cytomegalovirus infection
    102893495 (EGFR)
   05165 Human papillomavirus infection
    102893495 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102893495 (EGFR)
   01522 Endocrine resistance
    102893495 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102893495 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102893495 (EGFR)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102893495 (EGFR)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102893495 (EGFR)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102893495 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   102893495 (EGFR)
  Exosomal proteins of bladder cancer cells
   102893495 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase APH
Other DBs
NCBI-GeneID: 102893495
NCBI-ProteinID: XP_024902585
LinkDB
Position
Unknown
AA seq 1219 aa
MLNNCEVVLGNLEITYMQRNYDLSFLKTIQEVAGYVLIALNVAETIPLENLQIIRGNVLF
ENTHALSVLSNYGANKTGLRELPMRNLQEILQGAVRFNNNPLLCNVETIQWRDIVDSTFL
SNMSLDFQNQMSSCPKCDPSCPNGSCWGAGQENCQKLTRIVCAQQCSRRCRGRSPSDCCH
SQCAAGCTGPRESDCLVCHKFRDEATCKDTCPPLMLYNPTTYEMDVNPEGKYSFGATCVK
KCPRNYVVTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINA
TNIKHFKNCTSISGDLHILPVAFKGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGQFSLAVVGLHITSLGLRSLKEISDGDVVISGNQKLCYAD
TIRWQNLFGTFSQKTKIINNRNGRDCQAAGHVCNPLCSSEGCWGPEPKDCVSCRNVSRDR
ECVERCNLLEGEPREFVENSECVQCHPECLPQAMNVTCTGRGPDKCVKCAHYIDGPHCVK
TCPSGIMGENNTLVWKFSDANHVCHLCHRNCTYGCAGPGLEGCTYGPRIPSIATGIVGGL
LLVVVLALGVVLFLRRRYIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRVLKETEFKK
IKVLGSGAFGTVYKGLWNPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV
CRLLGICLTSTVQLVTQLMPFGCLLDYVREHKDNMLPRMRKVMYRTKTFVGCSAGAKRHP
GVYGPRDRRRVASSFSAKSLGLRMGFCHPSSWLPSASPCSPGGQLASVPSPHVPAFQGMN
YLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESI
LHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEVSALLEKGERLPQPPICTIDVYMI
MVKCWMIDAESRPKFRELVLEFCKMARDPQRFLVIQGDERMDLPSPTDSNFYRALMEEED
MEDVVDADEYLIPQHGFFHSPSTSRTPLLSSLSATSNTSAVACIDRNGQSCPLKEDSFLQ
RYSSDPTGALTEENINDTFLPVPEYMNQSIPKRPAGSVQNPVYHSQPLSPAAGREPHYQH
PHSSAVGNPEYLNTIRPASGDGPALWVQKGGHHISLDNPDYQQDFLPKEATSNGTFKGPA
AENAEYLRVAPASREFTGA
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgctgaacaactgtgaggtggtccttgggaacctggaaattacctatatgcaaaggaat
tacgacctttccttcttaaagaccatccaggaggtggccggctacgtcctcatcgccctc
aacgtggcggagacgatcccgctggaaaacctgcagatcatcagagggaacgtgctcttc
gaaaacacgcacgccttgtcggtcctgtccaactacggggcaaacaaaacggggctgcgg
gagctccccatgagaaacctgcaggaaatcctgcaaggcgccgtgcgattcaacaacaac
cccctcctctgcaatgtggagaccatccagtggcgggacatcgtggacagcactttcctg
agcaacatgtcgctggactttcagaaccagatgagcagctgcccaaagtgcgacccaagc
tgtcccaacgggagctgctggggtgcgggacaggagaattgccagaaactgaccaggatc
gtgtgtgcccagcagtgctccaggcgctgccgtggcaggtcgcccagcgactgctgccac
agccagtgtgcggccggctgcaccgggccgcgggagagcgactgcctggtctgtcacaag
ttccgggacgaagccacgtgcaaggacacctgcccgccgctcatgctgtacaaccccacc
acgtacgagatggacgtcaacccggagggcaaatacagcttcggcgccacctgcgtgaag
aaatgtccccgtaactatgtggtgacagaccacggctcgtgcgtccgcgcctgcagctct
gacagctacgaggtggaggaggacggggttcgcaagtgtaagaagtgcgaagggccttgt
cgcaaagtttgcaacggaataggaattggtgaatttaaagacacactttccataaatgct
acgaatatcaaacacttcaaaaactgcacctccatcagtggggacctccacatcctgccg
gtagctttcaagggtgactctttcactcacaccccgcctctggacccgaaggaactggac
attctgaaaaccgtgaaggagataacagggtttttgctgattcaggcctggccagaaaac
aggactgacctccatgctttcgagaacctggaaatcatacgtggcagaacaaagcaacat
ggccagttttctctcgcggtcgtcggcctgcacatcacgtcgctgggactacgctccctc
aaggagataagtgacggagacgtggtcatctcggggaaccagaagttgtgctacgcagac
accatacgctggcaaaacctatttgggaccttcagccagaaaaccaagattataaacaat
aggaatggacgagactgccaggccgcgggccatgtctgtaacccactctgctcgtcagag
ggctgctggggcccggagccaaaggactgtgtgtcctgcaggaacgtcagccgtgaccgg
gagtgcgtggagaggtgcaacctcctggagggcgagcccagggagtttgtggagaactct
gagtgcgtgcagtgccatccagaatgcctgccccaggccatgaacgtaacctgcacggga
cgcggaccagacaagtgtgtaaagtgtgcccactacatcgatggcccccactgtgtcaag
acctgcccgtctgggatcatgggagaaaacaacacgctggtctggaagttctcagatgcc
aatcacgtgtgtcacctgtgccaccgaaactgtacatacggctgcgctgggccgggtctc
gaaggctgcacgtatgggcccaggatcccgtccatcgccaccggcatcgtgggcggcctg
ctgctggtggtggtgctggccctcggggtcgtcctcttcctgcgcaggcgttacatcgtc
cggaagcgcacgctgcgccggctgctgcaggagagagagctcgtggagcccctcacgccc
agtggggaggcccccaaccaggctctcctgagggtcttgaaggagacggagttcaaaaag
atcaaggtgctgggctctggcgcattcggcacggtgtacaagggtctctggaacccagaa
ggcgagaaggtcaagatccccgtggctatcaaggagttgcgagaagccacgtctccaaaa
gccaacaaggaaattcttgatgaagcctacgtgatggccagcgtggacaaccctcacgtg
tgccgcctgctgggcatctgcctgacctccacagtccagctggtcacgcagctcatgccc
ttcggctgcctcctggactatgtccgtgagcacaaggacaacatgctcccaaggatgcgg
aaggtgatgtacaggacaaagacgtttgtgggctgctcggctggagcaaagcgccatcct
ggcgtttatgggccacgcgaccgcagacgagtggcctcgtctttcagcgccaagtctctg
gggctgcgcatgggcttctgccacccgtcttcctggctcccctcagccagtccatgctct
cccgggggccagctggcgtccgtgccctcaccccatgttcccgcgtttcagggcatgaac
tacctggaagaccggcgtttggtgcatcgtgacctggccgccaggaacgtcctggtgaag
acgccacagcacgtcaagatcacagacttcgggctggccaagctgctgggcgccgaggag
aaggaataccacgcggagggaggcaaggtgcctatcaagtggatggctttggaatcgatt
ttacaccgaatttatacccaccaaagtgacgtctggagctatggtgtcaccgtgtgggag
ctgatgacgttcgggtccaagccttatgatggcatcccggcgagcgaggtctcggccctg
ctggagaagggagagcgcctcccgcagccgcccatatgcaccatcgacgtctacatgatc
atggtcaagtgctggatgatagatgcagagagtcgccccaagttccgtgagttggtcctc
gaattctgcaaaatggcccgagacccccagcgcttccttgtcatccagggggacgagaga
atggacttgcccagccccacggactccaacttctaccgcgccctcatggaagaggaggac
atggaggacgtggtggacgcggacgagtacctgatcccgcagcacggcttcttccacagc
ccctccacgtcccgcacgcccctcctgagctccctgagtgccaccagcaacacttccgcc
gtggcttgcatcgacagaaacgggcagagctgtcccctcaaggaagacagcttcttacag
cgctacagctcagaccccaccggcgccttgaccgaggagaacatcaacgacactttcctc
ccagtgcccgaatacatgaaccagtccatccccaaaaggcccgcgggctctgtgcagaac
ccggtgtaccacagtcagcccctgagccccgccgccggcagagagccgcactaccagcac
ccccacagcagcgccgtgggcaaccccgagtatctcaacaccatccgccccgccagcggc
gacggccctgccctctgggtgcagaaaggaggccaccacattagcctggacaaccctgac
taccagcaggacttcctgcccaaggaagccacgtcgaacggcacgttcaagggcccggcc
gccgaaaacgcagagtacctgcgggtagccccggcgagccgcgagttcaccggcgcgtga

KEGG   Pteropus alecto (black flying fox): 102894001
Entry
102894001         CDS       T02993                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha
  KO
K05059  ciliary neurotrophic factor receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102894001 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102894001 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102894001 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pale00537]
    102894001 (CNTFR)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL6/12 receptor family
   102894001 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pale00537]
 Receptors
  102894001 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Mucin Ig_5
Other DBs
NCBI-GeneID: 102894001
NCBI-ProteinID: XP_006916101
LinkDB
Position
Unknown
AA seq 372 aa
MAAPVPWACCAVLAAAAAVVYTQRHSSQEAPHVQYERLGSDVTLPCGTANWDAAVTWLVN
GTDLAPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLRHQVFLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPAPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTTHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLVPLPTTKSCDPGELGSGGGPSAPFWISVPVTLAL
AAAAATASSLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccatgggcctgctgtgctgtgcttgctgccgccgctgccgttgtc
tacacccagagacacagttcgcaggaggcaccccatgtgcagtacgagcgcctgggttca
gatgtgactctgccttgtgggacagccaactgggatgcagctgtgacgtggctggtaaat
ggaacagacctggccccagacctgctcaatggctctcagctcgtactccgtggcctggaa
ctgggccacagtggcctctatgcctgcttccaccgtgactcctggcacctacgccaccaa
gttttcctacatgtgggcttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgccagcccccacctacatccccaacacc
ttcaatgtgactgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacatccgctacatgcacctgttctccaccatcaaatacaaggtctcg
ataagtgtcagcaatgccctgggccacaacgccacagctatcaccttcgacgagtttacc
attgtgaagcctgaccctccagaaaatgtggtagcccggccagtgcccagcaaccctcgc
cggctagaggtgacgtggcagaccccctcaacctggcctgaccctgagtcctttcctctc
aagttctttctgcgctaccgacccctcatcctggaccagtggcagcatgtggagctgtcc
gatggtacaacgcacaccatcacagatgcctacgctgggaaggagtatatcatccaggtg
gcggccaaggacaatgagatcgggacgtggagcgactggagcgtggccgcccatgccacg
ccctggactgaggaacctcgacacctcaccactgaggcccaggccccggagaccacgacc
agcaccaccagctcactggtacccctgcccaccacgaagagctgtgaccccggggagctg
ggcagcggcgggggaccctcagcacccttctggatcagtgtccccgtcaccctggccctg
gctgccgctgccgccactgccagcagtctcctgatctga

KEGG   Pteropus alecto (black flying fox): 102895362
Entry
102895362         CDS       T02993                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04072  Phospholipase D signaling pathway
pale04144  Endocytosis
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04810  Regulation of actin cytoskeleton
pale05163  Human cytomegalovirus infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102895362 (PDGFRA)
   04014 Ras signaling pathway
    102895362 (PDGFRA)
   04015 Rap1 signaling pathway
    102895362 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102895362 (PDGFRA)
   04020 Calcium signaling pathway
    102895362 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102895362 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102895362 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102895362 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102895362 (PDGFRA)
   04540 Gap junction
    102895362 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102895362 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895362 (PDGFRA)
   05206 MicroRNAs in cancer
    102895362 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102895362 (PDGFRA)
   05231 Choline metabolism in cancer
    102895362 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102895362 (PDGFRA)
   05218 Melanoma
    102895362 (PDGFRA)
   05215 Prostate cancer
    102895362 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102895362 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102895362 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102895362 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pale04090]
    102895362 (PDGFRA)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102895362 (PDGFRA)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102895362 (PDGFRA)
CD molecules [BR:pale04090]
 Proteins
  102895362 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 102895362
NCBI-ProteinID: XP_006922566
UniProt: L5JZI7
LinkDB
Position
Unknown
AA seq 1088 aa
MGTSHPALLVLGCLLAGPSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
LFDENSNVEIRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTEENEIEGRRIYIYV
PDPDVAFVPLGMTDYLVIVEDDDFAIIPCRTTDPDTPVTLLGSDGVVLASYDSRQGFNGT
FTVGLYICEATVRGRKFQTIPFNVYALKATSELDLEMEAPKTVYKSGETVVVTCAVFNNE
VVDLQWTYPGEVRGKGVTTLEETKVPFIKLVYTLRVPGATVKDSGEYGCAARQATREVKE
MKKVTISVHEKGFIEIKPNFSQLEAVNLHEVKHFVVDVQAYPPPRISWLKDNLTLIENLT
EITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIIVQNEDDAKSYTFELLTQVPSSILDLV
DDHHGATGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNISNIVTEVHLRDR
STVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVIIS
LIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGS
GAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLL
GACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSYV
ILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNL
LSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIP
LPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
NT seq 3267 nt   +upstreamnt  +downstreamnt
atggggacttcccatcccgcactcctggtcttaggctgtctccttgcagggccgagccta
atcctctgccagctttcattaccctctatcctcccaaacgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagcgaagtgagctggcagtacccc
ttgtttgacgagaactccaacgtggaaatcagaaatgaggagaacaacagtggccttttt
gtgaccgtgctggaagtggtcaatgcctcggcagcccacacggggctgtacacttgctat
tacaaccacacgcagacagaagaaaatgagattgaaggtcggcgcatttacatctacgtg
ccagacccagatgtagcctttgtacctttgggaatgacagattatttagtcatcgtggaa
gacgatgactttgccatcataccttgtagaacaaccgaccccgatactccggtaacttta
ctcggcagtgatggggtggtcctcgcctcctatgacagcagacagggctttaatggaacc
ttcaccgttgggctctatatctgcgaggccaccgtcagagggaggaagttccagaccatt
ccatttaatgtttatgctttaaaagcaacatcagaacttgatctagaaatggaagctcct
aaaactgtgtataagtcaggagaaacggttgtggtcacctgtgccgtctttaacaacgag
gtggttgaccttcagtggacttatcctggagaagtgaggggcaaaggcgtcacgacgctg
gaggaaaccaaggtccccttcatcaagctggtgtacacactgagggtccctggggccaca
gtgaaagacagtggagagtacggatgtgccgcccgccaggccaccagggaggtcaaagaa
atgaagaaagtcaccatttctgtccatgagaaagggttcattgaaatcaaacccaacttc
agccagttggaagctgtcaacctgcatgaagtcaaacatttcgtggtggacgtgcaggcc
tacccccctcccaggatatcctggctgaaagacaacctgactctgattgaaaacctcacc
gagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaagctg
attcgtgctaaggaagaagacagtggccattatactattatagttcaaaatgaagatgat
gcgaagagctatacttttgaactcttaactcaagttccctcatctattctggacttggtc
gacgatcaccatggcgctacagggggacagactgtgagatgcacagctgaagggacacct
cttcctgatattgaatggatgatttgcaaggatattaagaaatgtaataatgagacttca
tggacgattttggccaacaacatctcaaacatcgtcacggaggtccacctccgggacagg
agtacggtggagggccgggtgacgttcgccaaagtggaggagactattgcggttcgatgt
ctggctaagaatcttcttggggctgagaaccgagagctgaagctggtggctcccactctg
cgttctgaactcacggtggcagccgcagtcctggtgctcttggtgattgtgatcatctca
ctgattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagggtc
attgaatcaatcagccccgatggacatgaatatatttatgtggacccgatgcagctgcct
tatgactcgagatgggagtttccaagagatggactagtgctgggtcgtatcctgggatct
ggtgcatttgggaaagtggttgaaggaactgcctatggattaagccggtcccaacctgtc
atgaaagtggcagtaaagatgcttaaacccacagccagatccagtgaaaaacaagctctc
atgtctgaactgaagataatgactcacctggggccgcatttaaacattgtaaacttgctg
ggagcctgtaccaagtcaggccccatttacatcatcactgagtactgtttctatggggat
ttggtcaactatttgcataagaatagagacagcttcctgagccgccacccagagaagcca
aagaaagagctggacatcttcggattgaaccccgctgatgaaagcacgcggagttatgtt
attttatcttttgaaaacaatggtgactacatggacatgaagcaagctgataccacacag
tatgtccccatgctggaaaggaaagaggtttctaaatattcagacatccagagatcgctg
tatgatcgcccagcctcatataagaagaaatctatgttagattcggaagtcaaaaacctt
ctttcagatgataactcggaaggccttactttgttggatttgttgagctttacctatcag
gttgcccgaggaatggaatttttggcttcaaaaaattgtgtccaccgggacctggccgct
cgcaacgtcctcctggcacaagggaaaattgtgaagatctgtgactttggcctggccaga
gatattatgcacgattccaactacgtgtcgaaaggcagtaccttcctccctgtgaagtgg
atggctcctgagagcatcttcgacaacctctacaccacactgagcgacgtctggtcttac
ggcattctgctgtgggagatcttttcccttggtggcacaccctacccaggcatgatggtg
gattctactttctacaacaagatcaagagtgggtaccgaatggccaagcctgaccacgcc
accagtgaagtctatgagatcatggtgaagtgctggaacagtgagccggagaagagaccc
tccttttaccacctgagtgaaattgtggagaacctgctgcctggacaatataaaaagagt
tatgaaaagattcacctggacttcctgaagagtgaccatccggcggtggcacgcatgcgc
gtggacgctgacaatgcctacattggtgtcacctataaaaatgaagaggacaaactgaag
gactgggagggtggccttgatgagcagaggctgagtgcagacagcggctacatcatccct
ctgccggacatcgaccccgtgcctgaggaagaagacctgggcaagagaaacagacatagc
tcacagacctccgaagagagtgccattgagacaggttccagcagttctaccttcatcaag
agagaggatgagaccattgaagacatcgacatgatggatgacattggtatagactcctca
gacctagtggaagacagcttcctgtaa

KEGG   Pteropus alecto (black flying fox): 102896000
Entry
102896000         CDS       T02993                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102896000 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102896000 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102896000 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896000 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102896000 (IL5RA)
   04090 CD molecules [BR:pale04090]
    102896000 (IL5RA)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL3 receptor family
   102896000 (IL5RA)
CD molecules [BR:pale04090]
 Proteins
  102896000 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac fn3 LIFR_D2 Il13Ra_Ig EpoR_lig-bind
Other DBs
NCBI-GeneID: 102896000
NCBI-ProteinID: XP_006909259
LinkDB
Position
Unknown
AA seq 425 aa
MAWGGWNLIVMVLAFLILLGATVILPADLLSDEKSPLLPPVNFTVTVTGLAQVLLRWEPS
PDQERRSIKLGYHVKINGPQEDDYETRNTKSSRETILHKGFSASVQTIPWEGHTVPPSSW
VSAELSAPAGSPGTSAVNLTCTTNTVASNRTRSRQYQVSLRCTWLAGEASPEDTRYFLYY
RYGSQTEECRQYAQDASGRNVAGWFPATSIDGQGRGSXXXXXXXPAAPPTRPLDRLFALH
AIDQVNPPLNVTADIEGSRLSIRWDKPVSAFPTHCFDYEVEIYNARKGYLQVEKMRTQEF
TSAVHDISKYSIRVRAAVSSVCRTAGPWSEWTQPVVMGSDEQKAWTEWLLIVLTAAICFL
FVFSLTCRRCRLWATLFPPVPAPKSHIKDFIVTINYEKSGSGDTEVEVISYVDAPELEVL
DDFVF
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcctggggagggtggaatttgatcgtcatggtgcttgcatttctgattcttttgggg
gccacagtgatactgccagcagacttactttctgatgaaaaatccccgctgctcccgcct
gtcaatttcaccgtcaccgtcaccggtttggctcaggtcctgttacgctgggagccgagc
cccgatcaggagcgaaggagcatcaagctaggatatcacgtgaaaataaacggcccacag
gaagatgattacgaaaccaggaacacgaagagcagccgtgagaccatccttcacaaaggc
ttttcagccagcgtgcagaccatcccgtgggagggccacaccgtcccgccaagcagctgg
gtgtccgccgagctcagcgcccccgcagggtctcctggaacctcggctgtcaacttaact
tgcaccacgaacactgtggcgagtaaccgaacgcgctcacggcagtaccaggtctccctt
cgctgcacctggctggcgggcgaggcttcccctgaggacacgcgctatttcctctactac
aggtacggctcccagaccgaagaatgccgacaatacgcgcaggacgcgtcggggcgcaac
gtcgcgggctggtttcccgcgacttccatcgacggccaagggcgcggctcgcnnnnnnnn
nnnnnnnnnnctccagcagccccccccacacggcccctggaccggctgttcgccctgcac
gccatcgatcaagtaaaccctccgctgaacgtcacggcggacattgaaggaagccgtctc
tctatccgatgggacaaaccagtttctgcctttccaacccattgcttcgattacgaagtg
gaaatttacaacgcaaggaagggttatttgcaggtagaaaaaatgaggactcaggagttc
acctcagctgttcacgacatttccaagtactccattcgcgtgcgggcagcggtgagctcc
gtgtgcaggacagcggggccctggagtgagtggactcagcccgtcgtcatgggaagtgac
gagcagaaggcctggacggaatggcttctcatcgtgcttacggcagccatctgcttcctg
ttcgtcttctcgctcacctgtagaagatgtcgcttatgggccacgctgttcccgcccgtt
ccagcaccgaaaagccacatcaaggatttcatcgtaaccatcaactacgagaaatccggt
tctggtgacacggaagtcgaggtcataagttacgtggacgcgccggagctcgaggtcctg
gatgatttcgtgttttga

KEGG   Pteropus alecto (black flying fox): 102897194
Entry
102897194         CDS       T02993                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04210  Apoptosis
pale04630  JAK-STAT signaling pathway
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102897194 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102897194 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102897194 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102897194 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102897194 (CSF2RB)
   04090 CD molecules [BR:pale04090]
    102897194 (CSF2RB)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL3 receptor family
   102897194 (CSF2RB)
CD molecules [BR:pale04090]
 Proteins
  102897194 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind fn3 IL4Ra_N EpoR_lig-bind IL2RB_N1 Interfer-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 102897194
NCBI-ProteinID: XP_006914540
LinkDB
Position
Unknown
AA seq 949 aa
MSVCPTTKRPGDGRVLEGGCAVADDLGLARPPAGEEDSRPVSTWTLPGPGPTRASPSSFS
ADPQMLLTRRLLPIALLVLCWGSSLAGAQETIPMKTLRCHNDYTSRIICRWADTQDAQRL
INVTLYRRLNEGLPQPVSCDLSDDMPWSECPSLHCVPRTCIINYNLFVIADKDYFSFRPD
RPLDTQLTVTLAQHVQPPAPKDLHIDDAGDHFMLTWNVALEGFQSQWLSHLEFEVVYRRL
QDSWEEAPTLHSTSPKAILGPEHLIASSTYVARVRTRLRPGSGLSGRPSQWSPEVRWDSQ
PGDEAQPQNLQCLFDGGAVLSCSWEVRSRVTSSLSFTLFYKSSPNTQEKECSPVLREACG
PYIRHRCQIPVPDPESHSQYIVSVRPKEEEKFIESSNNIQMAPPTLNVTKGRDSYILRWE
VKKMAFSHIQHTFEVQYKKDAASWQESKTEPLQNTHSMSLPHLEPSTRYQARVRVKPYSG
YNGIWSEWSEECSWDTEWALPMWVLAVILVFITLALLPALRFCGMYGYRLNRKWEEKIPN
PSKSHLFQGSAGLWLPDSTSVLISGSASVKGPGASGFPGLDGVCPVVRRHSEVSPLTIED
PKVASDSPSEPHMTPAALDLPTEPPRSSQLCLSAPLSRPESQVFGFDFNGPYLSLPNLMG
QEPPPQTGMSQKPLPPGSLEYLCLPAGEQVQLTPLSQVRNPGQATGVERRPCLSAEGSPS
LESGAGPAPPAPGPMGGQGPEDSPTALSTASRGPEDSVMASGYVTTADPALTPPKGTPSA
SQVPPLGLPSDQNQSLSPALASGLPVAPGSLKPEYQGYVELPPTMGQSPKPPLESPAPLA
ASGPVLSPREPQAEVAPVSPHPEGLLVLQQVGDYCFLPGVGSGPLSPQSKSSSPGPCPQI
RDLDQVFQAKKPPCQAIPQVPAIQLFKALKQQDYLSLPPRDVGRPGEVC
NT seq 2850 nt   +upstreamnt  +downstreamnt
atgtcggtctgtcccaccactaagaggcctggcgatggcagagtcctggagggcggatgt
gcagtagcggatgacctgggtctggcccggcccccagccggggaggaagattccaggcca
gtgagcacctggaccctgcccggacctggacccacccgtgccagcccctcctcattcagc
gctgacccgcagatgctgctgacccggcggctgctccccatcgccctgctggttctgtgc
tgggggtccagcttggcgggagcccaagagaccatcccaatgaagaccctgcgctgccat
aatgactataccagtcgcatcatctgcaggtgggcagacacccaggatgcccagcggctc
atcaacgtgaccctctaccgcaggctgaatgagggcctcccacagccggtgtcctgtgat
ctcagcgatgacatgccctggtcagaatgcccgtccctccactgtgtgcccagaacatgc
atcatcaactacaaccttttcgtcattgctgataaagactacttctcattccgaccagac
aggcctctggacacccagctcactgttactctggcccagcacgtgcagccccccgcaccc
aaggacctccacatcgatgatgctggggaccatttcatgcttacctggaatgtggccctt
gagggtttccagagccagtggctgtcacacctggagtttgaggtggtctacaggcggctt
caggactcctgggaggaggcccccaccctccactccacctcccccaaggccatcctgggg
ccagagcacctcatagccagcagcacctacgtggcccgagtacgcacccggctgcgcccg
ggctcagggctctcgggacggcccagccagtggagcccggaggtccgctgggactcccag
ccaggggacgaagctcagccccagaacctccagtgcttgttcgacgggggtgccgtgctc
agctgctcctgggaagtgaggtcccgggtgaccagttcgctctccttcaccctcttctac
aagtccagccccaatacacaggagaaagaatgttcgccggtgctgagggaggcctgcggc
ccctacatccggcaccggtgccagattccggtgcccgatcccgaaagccacagccagtac
atcgtctctgttcggcctaaggaggaagagaaatttatagagagctcaaacaacatccag
atggctcccccgacgctcaacgtgaccaagggcagagacagctacatcctacgctgggaa
gtgaagaaaatggccttctcgcacatacagcacacctttgaggtccagtacaagaaggac
gcagcctcgtggcaggagagcaagacagaacccctccagaacacccacagcatgtcactg
ccacatctggagccctccaccaggtaccaggcgagagtgagggtcaagccctacagtggc
tacaatgggatctggagtgaatggagtgaggagtgctcctgggacactgagtgggctctg
cccatgtgggtcctggcggtcatcctggtcttcatcaccctcgccttgctcccggccctg
cgcttctgtggcatgtatggctacaggctgaaccggaaatgggaggagaaaatccccaac
cccagtaagagccacctgttccaggggagtgctgggctctggctcccagacagcacgtcg
gtcctcatcagcggaagcgcctcagtcaagggaccgggggccagcggcttccctgggctg
gacggggtgtgccccgtagtccgtaggcacagcgaggtgtcacctctcaccatagaagac
cctaaagttgccagcgactcaccttctgagcctcacatgactccagcagccttggacctg
cccacagagcctccccgcagctcccagctctgcctgtcggcccccttgagcaggcccgag
agccaggttttcggctttgacttcaacggcccctacctctccctgcctaacctcatgggc
caggagcctcccccacagacgggcatgagtcagaagccgctgcctccaggttccctggag
tatctgtgtttgcccgcaggggagcaagtgcagctgaccccactgtcccaagtgaggaat
ccaggccaggccacgggtgtggagaggaggccctgcctgagtgctgaggggagcccctcc
ctggagtcaggggcaggccccgcccctcctgctcctgggccgatgggtggtcagggccca
gaggacagccccacagctctgtccactgcctctaggggtcctgaggacagtgtcatggcc
tctggttatgtcaccactgcagacccggcactcactccacccaaagggaccccgtctgcc
tcccaggttccccctctgggcctcccctcagaccagaaccaaagcctcagtcccgcactg
gccagtgggctccccgtagccccaggctccctaaagccagagtatcagggttacgtggag
ctccctcccaccatgggccagtcccctaagccccctctggaaagtcctgccccgcttgca
gctagcggccctgtcctgagcccaagagagccccaggcagaggtcgccccagtctccccg
caccccgaggggctcctggtcctgcaacaggtgggggattactgcttccttcctggagtg
gggtccggccctctctcacctcagagtaagtcctcttctccgggaccctgcccccagatc
agggacctggaccaggtgttccaggccaagaagcccccctgccaggccattccccaggtg
ccagccattcagctcttcaaagccctgaaacagcaggactacttgtcactgccccccagg
gatgtcggccggcctggggaggtgtgctga

KEGG   Pteropus alecto (black flying fox): 102897874
Entry
102897874         CDS       T02993                                 

Gene name
IL13RA1
Definition
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102897874 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102897874 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102897874 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102897874 (IL13RA1)
   04090 CD molecules [BR:pale04090]
    102897874 (IL13RA1)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL3 receptor family
   102897874 (IL13RA1)
CD molecules [BR:pale04090]
 Proteins
  102897874 (IL13RA1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind LIFR_D2 EpoR_lig-bind GP88
Other DBs
NCBI-GeneID: 102897874
NCBI-ProteinID: XP_006904770
UniProt: L5L586
LinkDB
Position
Unknown
AA seq 424 aa
MELPVGLFGLWALLFCATSEGDAAPKETQPPVTNLSVSVENLCTVIWTWNPPERASPNCS
LWYFSHFGNKQDKKIAPETHRSKEVPLNERICLQVGSQCSTNESDNPSTLVEKCISPPEG
DPESAVTELQCVWHNLSYMKCTWLPGRNTSPDTNYTLYYWHSSLGKILQCENIYKEGQHI
GCSFTLTKSKDSNFDQHSVQVMVKDNVGKIRPSFNIVPLTSHVQPDPPHIKNLFFQHGDL
YVLGKTPQNFVSRCLSYQIEVNNSQTETHYILSVEEPKCDNLEFEGNLEGTICFWVPGVL
PDTLNTVRIRVKTNKLCYEDDKLWSNWSPVMSIGKKANPTFYIIMLLIIPVIVAGAIIAL
LLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIENLK
RASQ
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggagctgccggtggggctcttcggactgtgggcgctgctgttttgcgccaccagtgaa
ggagacgcggcgcccaaggaaactcagccaccagtgacgaatttgagtgtttctgttgaa
aacctctgcacagtaatatggacatggaatcctcctgagagagccagcccgaattgtagt
ctgtggtatttcagtcattttggcaataagcaggataagaaaatcgctccagaaactcat
cgttcaaaagaagtgcctctgaacgagaggatttgtttgcaagtggggtcccagtgtagc
accaatgaaagtgacaatcctagcactttggtggaaaagtgcatctcaccccccgaaggt
gatccagagtcagctgtgactgagctacaatgtgtttggcacaacctgagctacatgaag
tgtacttggctccctggaaggaacacaagtcctgacactaactataccctctactactgg
catagcagcctgggaaaaattcttcaatgtgaaaatatctataaagaaggtcaacacatt
ggttgttcctttactctgactaaatcgaaggattccaatttcgaccaacacagtgtccaa
gtgatggtcaaggataatgtaggaaaaattagaccatccttcaacatagtgcctttaact
tctcatgtgcaacctgatcctccacatattaaaaatctcttttttcaacatggtgacttg
tacgtgctagggaagactccacagaattttgttagcagatgcttatcttatcaaatagaa
gtcaataacagccaaacagagacacattatattttatccgttgaagaacctaaatgtgat
aatttggaatttgagggaaacctggagggtacaatctgtttctgggtccctggtgttctt
cctgatactttgaacacagtcagaataagagtcaaaacaaataaattatgctacgaggat
gataaactctggagtaattggagtccagtgatgagtataggtaagaaggccaatcccacg
ttctacataatcatgttactcatcattccagtaattgttgcaggtgcaatcatagccctt
ctgctttatctaaaaaggctcaagatcattatattccctccaattcctgatcctgggaag
atttttaaagaaatgtttggagaccagaatgatgataccctgcactggaagaaatatgac
atctatgagaagcaaaccaaagaagaaactgactctgtagtgctgatagaaaacctgaag
agagcctctcagtga

KEGG   Pteropus alecto (black flying fox): 102897878
Entry
102897878         CDS       T02993                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102897878 (CSF3R)
   04151 PI3K-Akt signaling pathway
    102897878 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102897878 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102897878 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102897878 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102897878 (CSF3R)
   04090 CD molecules [BR:pale04090]
    102897878 (CSF3R)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  Prolactin receptor family
   102897878 (CSF3R)
CD molecules [BR:pale04090]
 Proteins
  102897878 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind ObR_Ig fn3_2
Other DBs
NCBI-GeneID: 102897878
NCBI-ProteinID: XP_024897237
LinkDB
Position
Unknown
AA seq 936 aa
MLGLSHQGKQPILQIRIIYRLDIDIDIYPHILPTHNYLYLLPKSFSQLPYIPPHFSPHVL
GSEARSLKNAYSPALPGRGVTHGPFSSIPGLEGCGHISLSASTVRLGDAITASCIIKQNC
SYLGPESQILWKLGTELLPGGKQQRLPDGTQESIITLPHLNNPWALLSCYLRWSNSLQMV
DQAELQAGYPPFTPHNLSCFMNLTTNCLTCQWEPGPDTHLSTNFTLKSFKSRGNCQTQEE
TIPDCVSEDGQSHCSIPRKHLQLYQTMGIWVQAENVLGTSVSPQLCLDPMDVVKLEPPTL
WALGPSSEVAPPQPGCLQLHWELWKPSLFIEQNCELRHKPQLGEASWALVGPLSSRTFHY
KLCGLLPSTAYTLQIRCIRHPLPGHWSEWSPSLKLTTPEQAPIVRLDTWWRQRQLDPRTV
DVQLFWKPMPLEEDRGQIQGYLVSWRPSGQLETVSPLCNTTELNCTFHLPSEAREVILVA
YNTGGTSRPTPVVFLKSGGPPLGRLYTVAQDPHSLWVGWEPSKPQPRGYVIEWGLHTPSP
SGSHKTWKMEHNGSIAGTLLQENIWPFQLYEITVTPLYQDTIGPSQHIYAYSQETAPSHA
PELHLKHIGKTWAQLEWVPQAPELGKSPLTHYTIFWTNAQGQSFSTILNASSHGFVLHGL
EPASLYHVHLMVTSQGGATNSTSLILVTLGLEESELYIILGLFGLLLLLTCLCGAAWLCC
RPSRKNPLWPSVPDPAHSSLGSWVPTITAEVRIRREREMELGISEISNALTLCPCVQEIF
QLPSLWDPSVLPITKITVLEEEEKKPGPWESNDSSGTCGLPTLVQAYVLQGDPRAPSIQP
QSQSGTNDQVLYGQLLGSPASPVPGHYIRCDSTQPLLGGLTPSPKSYENLWFQTSPQRTP
EPLVPNQEDDCVFGPLLDFPLLQGLQVHGVEGLGVF
NT seq 2811 nt   +upstreamnt  +downstreamnt
atgttgggactatctcaccagggaaagcagcctatactacaaatcaggattatatataga
ttagatatagatatagatatatacccacacattttacccacacataactatctctatctc
ctccccaagagcttctcacagctcccatacatacctccccatttcagcccccatgtcttg
gggagtgaagcaagaagtctaaaaaatgcttatagcccagctctgccaggcagaggagtc
actcatggccctttctcttccatcccaggcctggaggggtgcgggcacatcagcctctca
gcctccaccgtccgcctgggggatgccatcacagcctcctgcatcatcaaacagaactgc
agctacctgggcccagagtcacagattctatggaaactaggaacagagcttctgcctggg
ggaaagcagcagcgcctgccagatgggacccaggaatccatcatcaccttgccccacctc
aacaatccttgggcccttctctcctgctatctgcgctggagcaacagcctacagatggtg
gaccaggctgagctgcaggcaggctaccctccgttcacaccccacaacctgtcctgcttc
atgaacctcacaaccaactgcctcacctgtcagtgggagccaggacctgacacccacctg
tccaccaacttcaccctgaagagctttaagagccggggcaactgccagacccaagaggaa
accatccctgactgcgtgtctgaagacgggcagagccactgctccatcccacgcaaacac
ctgcagctgtaccagactatgggcatctgggtacaggcagagaacgtgctggggaccagt
gtgtccccacagctgtgccttgatcccatggacgtcgtgaaattggaaccccccacactg
tgggccctgggccccagctctgaggtggccccaccccagccaggctgtctacagttgcac
tgggagttatggaagccaagcttgttcatagaacagaattgtgagctgcgccacaagccc
cagcttggagaagccagctgggccctggtgggccccctgtcctccaggaccttccactat
aagctctgcgggctcctcccatccacagcctacaccctgcagatacgctgcatccgccac
cccctgcctggccactggagcgagtggagccccagcctgaagctgaccaccccagaacag
gcccccatcgtcagactggacacatggtggcggcagaggcagctggaccccaggacagtg
gatgtgcagctgttctggaagccaatgcccctggaggaagacagggggcagatccaagga
tacctggtctcctggagaccctcaggccagctggagacagtctcacctctctgcaacacc
acggagctaaactgcaccttccacttgccttcagaagcccgggaggtgatccttgtggcc
tataacacaggcgggacctctcgtcccaccccagtggtcttcttgaagagcggaggccca
cccctgggcagactctatacagtggcccaagaccctcacagcctctgggtgggctgggag
ccctccaaacctcagcctcggggctatgtgattgagtggggcctgcatacccccagcccc
agcggcagccataagacctggaagatggagcataatggaagcattgcagggaccctacta
caagagaacatctggccctttcagctctacgagatcactgtgactcccctgtaccaggac
accattggaccctcccagcatatctatgcctactcccaagagacggccccgtcccacgcc
ccagagctgcatctaaagcacattggcaagacctgggcccagctggagtgggtgccccag
gcccctgagctggggaagagcccccttacccactacaccatcttctggaccaatgcgcag
ggccagtccttctccaccatcctgaatgcttcctcccatggctttgtcctccacggccta
gagcctgccagcttgtaccacgtccacctcatggttaccagccagggaggggccaccaac
agtacaagcctcatcctggtgaccttgggcctagaggagtctgaactgtacatcatcctg
ggcctgttcggcctcctgctcttgctcacctgcctctgtggggctgcctggctctgctgc
agacccagcagaaagaatcccctctggccaagtgtcccagacccagcccacagcagcctg
ggctcctgggtgcctaccatcacggcagaggtgagaatacggagggaaagggaaatggag
ctggggatatctgaaataagtaatgccctcaccctatgtccttgtgtccaggagatcttc
cagctgcccagcctttgggaccccagcgtgctacccatcaccaagattacagttctggag
gaagaagagaagaagccagggccctgggagtctaatgacagctcaggaacctgtggcctt
cccaccttggtccaggcctatgtgctccagggggacccaagagcaccttctatccagccc
cagtcccagtctggcaccaatgaccaggtcctttatgggcagttgctgggcagccccgcc
agcccagtgccagggcactacatccgctgtgactccactcagcccctcttggggggcctt
acccccagccccaagtcttatgagaacctctggttccagaccagcccccagaggaccccg
gagcctctagtcccaaaccaggaggatgactgtgtctttgggccactgcttgactttcct
ctcctgcagggtctccaggtccatggggtggaagggctgggggtcttctag

KEGG   Pteropus alecto (black flying fox): 102899031
Entry
102899031         CDS       T02993                                 

Gene name
IL10RB
Definition
(RefSeq) interleukin-10 receptor subunit beta precursor
  KO
K05135  interleukin 10 receptor beta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04630  JAK-STAT signaling pathway
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102899031 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102899031 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102899031 (IL10RB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102899031 (IL10RB)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102899031 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102899031 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102899031 (IL10RB)
   04090 CD molecules [BR:pale04090]
    102899031 (IL10RB)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL10/28 receptor family
   102899031 (IL10RB)
CD molecules [BR:pale04090]
 Proteins
  102899031 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 102899031
NCBI-ProteinID: NP_001307206
UniProt: G5CBR2
LinkDB
AA seq 327 aa
MARNRWSWLGSCLLVSALGMVPPPENVRMNSVNFQNILQWESPAFPKAGLTFTAQYLSYK
KFQDMCTSTALTECDFSSLSKYGDHTLRVRAELAEEHSDWVNVTFSPVDDTIIGPPGMQV
EALANSLHIRFLAPKIEKEHETWTMKNIYNSWAYNVQYWKNGSDEKILVTCQYDFEVLRN
LEPWTTYCVQVQGFLPDRNKTGEWSEPVCEQTVNDETAPSWIVVAIILTASVCVACLLLL
GCFALMWCIYKKTKYAFAHGNKLPQHLKEFLGHPHHSRLLFFSFPLSDENDVFDKLSVVT
EVSESSKQNPGDSCSLRTPAGQGLLSS
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcgcgcaaccgctggagctggctgggcagctgcctcctggtgtcagcattaggaatg
gtaccgcctcctgaaaacgtcagaatgaattcagttaattttcagaacattctccaatgg
gagtcgcctgcttttcccaaagcgggtctgactttcacagctcagtacctaagttacaag
aaattccaggatatgtgcacaagtactgccctgacggaatgtgatttctcaagtctttcc
aagtatggcgaccacaccttgagagtcagggccgaacttgcagaggagcactcagactgg
gtgaacgtcaccttctctcctgtggatgacaccattatcggacctcctggaatgcaagta
gaagcgcttgctaattctttacatatacgtttcttagcccccaaaattgagaaggaacat
gaaacatggaccatgaagaatatttataactcatgggcttataatgtgcaatattggaag
aacggctctgatgaaaagattctagttacttgtcagtatgacttcgaggtcctcagaaat
ctcgagccgtggacgacttattgcgttcaagttcaaggatttcttcccgatcggaacaaa
accggggaatggagtgagcccgtctgtgagcaaaccgtcaatgacgaaacagccccctcg
tggatcgtcgtggccatcatcctcacggcctcggtgtgcgtggcctgcctgctcctcctt
ggctgcttcgccctgatgtggtgcatttacaagaagaccaagtacgccttcgcccatggg
aacaaacttccacagcacctgaaagagtttttgggccatccgcatcacagcaggcttctg
tttttctccttccccctgtctgatgagaacgacgtttttgacaaactgagtgtcgtcaca
gaagtctctgaaagcagcaagcagaatcctggggacagctgcagcctcaggaccccagct
gggcagggcttgctctccagctag

DBGET integrated database retrieval system