KEGG   Pteropus alecto (black flying fox): 102878053Help
Entry
102878053         CDS       T02993                                 

Gene name
MRE11
Definition
(RefSeq) double-strand break repair protein MRE11 isoform X1
  KO
K10865  double-strand break repair protein MRE11
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03440  Homologous recombination
pale03450  Non-homologous end-joining
pale04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102878053 (MRE11)
   03450 Non-homologous end-joining
    102878053 (MRE11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102878053 (MRE11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pale03032]
    102878053 (MRE11)
   03400 DNA repair and recombination proteins [BR:pale03400]
    102878053 (MRE11)
DNA replication proteins [BR:pale03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     102878053 (MRE11)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     102878053 (MRE11)
    BRCA1-C complex
     102878053 (MRE11)
   NHEJ (non-homologous end-joining)
    MRX complex
     102878053 (MRE11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 102878053
NCBI-ProteinID: XP_006907543
LinkDB All DBs
Position
Unknown
AA seq 710 aa AA seqDB search
MTSTDAPDDENTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLAQENEVDLILFGGD
LFHENKPSRKTLHSCLELLRKYCMGDRPVQFEIISDQSVNFGFSKFPWVNYQDCNLNISI
PIFSIHGNHDDPTGADALCALDILSCAGFINHFGRSMSVEKIDISPVLLQKGNTKIALYG
LGSIPDERLYRMFLNKKVTMLRPKEDENSWFNLFVIHQNRSRHGSTNFIPEQFLDEFIDL
VIWGHEHECKIAPTKNEQQLFYVSQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMQKIP
LHTVRQFFMEDVILADHPDIFNPDNPRVTQAIQNFCLEKIEELLENAERERLGNPRQPDK
PLIRLRVDYSGGFEPFNVLRFNQKFVDRIANPKDVIHFFRRREQKENTGEEINFGKFITR
PSEGMTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEK
TQRFLKERHIDALEDKIDEEVRRFRESRQKNTNEEDDEVREAMTRARALRSQSEDSASAF
SANDLMSIDMAEQMADDSDSSISAADNKGRGRGRGRRGGRGQNSVSRGGSQRGRAGTGAE
TSTRSRSSKATMSTSRNMSIIDAFGSARQQPSQNVTTKSYSEVIEVDESDVEEDIFPTTS
KTDQRWSNTSSSSSKCMSQSQKSKGVNFESDEDDDDDPFMNISSLRRNRR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgacttctacagatgcccctgatgatgaaaatacatttaaaatcttagttgcaacggac
attcatttgggatttatggagaaagatgcagtcagaggaaatgatacctttgtcacattt
gatgaaattttaagacttgcccaggaaaatgaagtggacttaattttgttcggtggtgac
ctttttcatgaaaataaaccctcaagaaaaacattacattcctgccttgagttattaaga
aaatattgcatgggtgatcgtcctgtacagtttgaaattatcagcgatcagtcagtcaac
tttggttttagtaagtttccatgggtgaactaccaagattgcaatctgaacatttcgatt
ccaatattcagtattcatggcaatcatgatgatcctacaggggcagatgcactttgcgct
ctggatattttaagttgtgctggatttataaatcactttgggcgttcaatgtctgtggag
aagatagacattagtccggttttgcttcaaaaaggaaacacaaaaattgctctatatggc
ttaggatccattccagacgaacggctctatcgaatgttccttaataaaaaagtaacaatg
ctgagaccaaaagaagatgagaactcttggtttaacttattcgtgattcatcagaacagg
agtagacatggaagtactaacttcattccagaacaatttttggatgaattcattgatctt
gttatctggggccatgaacatgagtgtaaaatagccccaaccaaaaatgaacaacaactc
ttttacgtatcacaacctggaagttcagtggttacttctctttctccaggagaagctgta
aagaaacatgttggtttgctgcgtattaaaggaaggaagatgaacatgcagaaaattcct
cttcacacagtacggcagttttttatggaggatgttattctggcagatcatccagatatt
tttaacccagataatcctagagtaacccaagccatacaaaacttctgtttggagaagatt
gaagagctgcttgaaaatgctgaacgggaacgtctgggaaatcctcgacagccagataag
cctcttatacgactgcgagtggactatagtggaggttttgaacctttcaatgttcttcgc
tttaaccagaaatttgtggatcgaatagctaatccaaaagatgttatccattttttcagg
cgtagagaacagaaggaaaacacaggagaagagatcaactttgggaaattcattacaaga
ccttcagaaggaatgactctaagggtggaagaccttgtaaaacagtattttcaaactgca
gagaagaatgtgcagctctcacttctaacagaaaggggaatgggtgaagcagtacaagaa
tttgtggacaaggaagagaaagatgccatagaggaattagtgaaataccagttggaaaaa
acacagagatttcttaaagaacgtcatattgatgccctagaagataaaattgatgaagag
gtacgtcgtttcagagaaagcagacaaaaaaatactaatgaagaagatgatgaagttcga
gaggccatgactagggccagagccctgagatctcagtcagaggactccgcttctgccttt
agtgctaatgaccttatgagtatagatatggcagaacagatggctgatgactcggatagt
agcatttcagcagcagacaacaaaggaagaggccgaggaaggggccgaagaggaggaaga
gggcagaattcagtgtccagaggaggatctcaaagaggaagagcaggcaccggtgcagaa
acttctactcgaagcagaagttcaaaggccactatgtcaacatctagaaatatgtctatt
atagatgcctttggatctgcgagacagcagccttctcaaaatgttactactaagagttat
tcggaggtgattgaggtagatgaatcagatgtggaagaagacatttttcctaccacttca
aaaacagatcaaaggtggtcgaacacgtcatcatcatcaagcaaatgcatgtcccagagc
caaaaaagtaaaggggtcaattttgaatcagatgaggatgatgatgatgatccttttatg
aacattagttctttaagaagaaacagaagatga

DBGET integrated database retrieval system