KEGG   Pteropus alecto (black flying fox): 102878133
Entry
102878133         CDS       T02993                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X4
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04020  Calcium signaling pathway
pale05200  Pathways in cancer
pale05216  Thyroid cancer
pale05223  Non-small cell lung cancer
pale05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102878133 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878133 (RET)
   05230 Central carbon metabolism in cancer
    102878133 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    102878133 (RET)
   05223 Non-small cell lung cancer
    102878133 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102878133 (RET)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102878133 (RET)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  RET family
   102878133 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD4 RET_CLD3 Pkinase Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 102878133
NCBI-ProteinID: XP_015442090
LinkDB
Position
Unknown
AA seq 1113 aa
MAKATASTAGLRWLLLLPLFGEAPLGLYFSRDAYWEKLYVDQPAGMPLLYVHALRDVPEE
VPSFRLGQYLYSAYRTRLNENDWIRIQEDTGLLYLNWSLDHSSWEKLSVRNGGFPLLTVY
LQVFLSPTYLREGECQWPGCARVYFSFINTSFPVCDSLKPRELCFPETGLSFRIRENRPT
GTFHQFRLLPVQFLCPNISVAYRLLGGESLPFHCAADSLEVSTRWALDREHREKYELVAA
CTVRVGAREEQVMVPFPVTVYDEDDSAPTFFGGVDTASAVVEFKRKEGTVVATLHVFDAD
VVPASGELLRRYTSTLLPRDAWTFQTFRVEHSPNETLVQANGSFVRATVHDYRLVLNRSL
PISESRALQLAVLVNDSDFQGPGEGILLLHFNVSVLPVSLHLPSAYSFTVSRRAHRFAQV
GKLCVENCQEFTGIHVQYKLQLSSTNCSALGVVTSAEDNMGTLFVNDTEALQRPECTQLQ
YTVLASDRPTHRQAQAPLLVTIEGTYMAEEPGCPLSCAVSKRRPECEECGGLGSLTGRCE
WRQGDGKGISRNFSTCSPSIKTCPDGHCDSVESRNSNICPQDCLRGGSIIGGHEPGERWG
IRAGFGTCNCFPEEKKCFCEPEDSQDPLCDELCRTVIAAAVLFSFIISVLLSTFCIHRYH
KNAHKPPIASAEMTFRRPAQAFPVSYSSSSARRPSLDSMENQVSVDAFKIPEDPKWEFPR
KNLVLGKTLGEGEFGKVVEATAFRLKGKTGYTTVAVKMLKENASPNELRDLLSEFNLLKQ
VNHPNVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKAGPGYVGSRGSRNSSYLDNP
DERALTMGDLISFAWQISRGMRYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYE
EDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLF
NLLKTGYRMEKPDNCSEEMYSLMLQCWKEEPDKRPVFADISKDLEKMMVKRRDYLDLAAS
TPSDSLLYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPEESPVPLTRAD
GTNTGCPRYANDSVYANWMVSPSAAQLMDSFDS
NT seq 3342 nt   +upstreamnt  +downstreamnt
atggcgaaggcgacggccagcaccgcggggctgcgatggctcctgctgctgccgctgttc
ggcgaagccccactgggactctacttctccagggatgcttactgggagaagctatatgtg
gaccagccggcgggcatgcctctgctctatgtccacgccctgcgtgatgtccccgaggag
gtgcccagcttccgcctgggccagtacctctacagcgcctaccgcacacggctgaatgag
aatgactggatccgtatccaggaggacacaggccttctgtacctgaactggagcctggac
cacagctcctgggagaagctcagcgtccgcaatggcggcttccccctgctcaccgtctat
ctccaggtctttctgtcgcccacatacctgcgtgagggcgagtgccagtggccaggctgt
gcccgcgtatacttctccttcatcaatacctccttccctgtgtgtgactccctgaaaccc
cgggagctctgcttccctgagacaggcctctccttccgcattcgtgaaaacaggccaact
ggcaccttccaccagttccgcttgttgcctgtgcagttcctttgccccaacatcagcgtg
gcctacagactactgggaggtgagagtctacccttccactgtgctgcggacagcctggag
gtgagcacgcgttgggccttggaccgcgaacaccgggagaagtacgaactggtggcagcg
tgcaccgtgcgcgtgggcgcgcgcgaggagcaggtgatggtacccttccccgtgaccgtg
tacgacgaggacgactcggctcccaccttcttcggtggcgtcgacaccgccagcgctgtg
gtggaattcaagaggaaggagggaactgtggtggccacactacatgtcttcgatgcagat
gtggtgccagcatccggggagctcctgcgccggtacacaagcacactgctccccagggat
gcctggaccttccagaccttccgtgtggagcactcacccaacgaaaccttggtccaggcc
aacggcagctttgtgcgggcaaccgtgcatgactataggctggttctcaaccgcagcctc
cccatctcagagagccgtgccctgcagctggctgtgctggtcaatgactcggacttccag
ggcccaggggagggcatcctcctcctccacttcaatgtgtctgtgttgcccgtcagcttg
cacttgcccagcgcctattccttcactgtgagcaggagggcccaccgctttgcccaggtt
gggaaactctgtgtggaaaactgccaggagttcaccggcatccatgtgcaatacaaactg
cagctctccagtaccaactgtagtgccctgggagtggttacctcagccgaggacaacatg
gggaccctgttcgtgaatgacacagaggccctgcaacggcctgagtgtacccagctccag
tacacagtgctggcctctgaccggccaacccacaggcaggcccaggctccactgctcgtc
actatagagggtacatacatggctgaggagccgggctgccccctgtcctgtgcagtcagc
aagaggcggcctgagtgtgaggagtgcggcggcctgggctctctgacaggcaggtgcgag
tggagacagggagacggcaaagggatctccaggaacttctccacctgctcccccagcatc
aagacctgccctgatggccactgtgactctgtggagagcagaaattccaacatctgcccc
caggactgcctccggggcggcagcatcattggtgggcatgagccaggggagcgttgggga
attagagccggctttggtacctgcaactgcttccctgaggagaagaagtgcttctgtgag
ccagaagacagccaggacccactatgtgatgagctctgccgcactgtgatcgcagcagct
gttctcttctccttcatcatctctgtgctgttgtccaccttctgcatccaccgctaccat
aagaacgcccacaagccgcccatcgcctcagccgagatgaccttccgccggccagcccag
gccttcccagtgagctactcctcgtctagtgcccgccggccctcactagattccatggag
aaccaggtctctgtggatgccttcaagatcccggaggatccaaagtgggaattccctcga
aagaacttggttcttggaaaaactctgggagaaggtgaatttggaaaagtcgtcgaagca
acagccttcaggctaaaaggcaaaacagggtacacgaccgtggccgtgaagatgctgaaa
gagaacgcctccccaaacgagctgcgggacctactgtcagaattcaacctcctgaagcag
gtcaaccaccccaatgtcatcaagctgtatggggcctgcagccaggatgggccactcctc
ctcattgtggagtatgctaagtacggctccttgcgcggcttcttgcgagaaagtcgcaag
gcaggacccggctatgtgggcagcagaggcagccgcaactccagctaccttgacaacccg
gatgagcgggccctgaccatgggcgacctcatctcctttgcctggcagatttcacgtggg
atgcggtacctggccgagatgaagcttgtccatcgggacttagcagccagaaatgtcctg
gtagctgaggggcggaagatgaagatttcagactttggcctgtcccgagatgtgtatgaa
gaggattcctacgtgaaaaggagcaagggtcggattccagtcaaatggatggcaattgag
tcccttttcgatcatatctacaccacccaaagtgatgtgtggtcctttggtgtcctcctg
tgggagattgtgactttggggggcaacccctacccagggattcctcctgagcggctcttc
aaccttctgaagacaggctatcggatggagaagcctgacaactgcagtgaggagatgtac
agtctgatgctgcagtgctggaaggaggagccagacaagaggccagtgtttgctgacatc
agcaaagacctggagaagatgatggttaagagaagagactacttggacctggccgcatcc
accccatccgactccctgctttatgatgatggcctctcagaggaggagacgcccctggtg
gactgtaataatgctcccctccctcgagccctcccctccacgtggattgaaaacaaactc
tatggcatgtcagacccgaactggcctgaagagagtcctgtaccactcacgagagccgat
ggcactaacactgggtgtccaagatatgcaaatgatagtgtatatgctaactggatggtt
tcaccctcagcggcacaattaatggactcgtttgatagttaa

KEGG   Pteropus alecto (black flying fox): 102891447
Entry
102891447         CDS       T02993                                 

Gene name
KIF5A
Definition
(RefSeq) kinesin heavy chain isoform X4
  KO
K10396  kinesin family member 5
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04144  Endocytosis
pale04728  Dopaminergic synapse
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102891447 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102891447 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102891447 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102891447 (KIF5A)
   05012 Parkinson disease
    102891447 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    102891447 (KIF5A)
   05016 Huntington disease
    102891447 (KIF5A)
   05020 Prion disease
    102891447 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    102891447 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102891447 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102891447 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pale04812]
    102891447 (KIF5A)
   04147 Exosome [BR:pale04147]
    102891447 (KIF5A)
Membrane trafficking [BR:pale04131]
 Others
  Actin-binding proteins
   Others
    102891447 (KIF5A)
Cytoskeleton proteins [BR:pale04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     102891447 (KIF5A)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102891447 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATG16 Spc7
Other DBs
NCBI-GeneID: 102891447
NCBI-ProteinID: XP_006909017
UniProt: L5KWX4
LinkDB
Position
Unknown
AA seq 1032 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDATLGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQQELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSMELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDADEMKKALELQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKNEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
PAPSTTSDMYFANSCTGSGTMSSGSPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcggagaccaacaacgaatgtagcatcaaggtgctctgccgatttcggcccctgaac
caggccgagattctgcggggggacaaattcatccccatttttcaaggggacgacagcgtc
gttattgggggaaagccatatgtctttgaccgtgtatttcccccaaacacgactcaggag
caagtttatcatgcatgtgccatgcagattgtcaaagatgtccttgctggctacaatggc
accatatttgcttatggacagacatcctcaggaaaaacacatactatggagggaaagctg
catgaccctcagctgatgggaattattcctcgaattgcccgagacatcttcaaccacatc
tactccatggatgagaatcttgagttccacatcaaggtttcttactttgagatttacctg
gacaaaattcgtgaccttctggatgtgaccaagacaaatctgtctgtgcatgaggacaag
aaccgggtgccatttgtcaagggttgtactgaacgctttgtgtccagcccagaggagatt
ttagatgtgattgacgaggggaaatcaaaccgtcatgtggctgtcaccaacatgaatgag
cacagctctcgcagccacagcatcttcctcatcaacatcaagcaggagaacatggagact
gagcagaagctcagtgggaagctgtatctggtggacctggctgggagcgagaaggtcagc
aagactggagcagagggagccgtcctggatgaggcaaagaatatcaacaagtcactgtca
gccctggggaatgtgatctctgcgctggctgagggcactaaaagctatgttccatatcgt
gatagcaaaatgacacggattctccaggactccctgggaggaaactgccggacaactatg
ttcatctgctgctcaccatccagctacaatgatgcagagaccaagtctaccctgatgttt
gggcagcgggcaaagactattaagaacactgcctcagtgaatctagagttgactgctgag
cagtggaagaagaaatatgagaaggagaaggaaaagacaaaggctcagaaggaaacaatt
gcaaagctggaggctgagctgagccgctggcgcaatggagagaatgtgcctgagacagag
cgcctggccggggaggatgcaaccttgggagctgagctctgcgaggagacaccagtgaat
gacaactcctccatcgtggtgcgtattgcacccgaggagcggcagaagtatgaggaggaa
atccgccgcctctacaagcagctcgatgacaaggatgatgagatcaaccagcagagccag
ctcatagagaagctcaagcagcaaatgctggaccaggaagagctgctggtgtccactcga
ggtgacaatgagaaggtccagcaagagttgagccacctgcagtcggagaacgatgctgct
aaggatgaggtgaaggaagtgctgcaggccctggaggagctggctgtgaactacgaccag
aagtcccaagaggtggaagaaaagagccagcagaaccagcttctggtggatgagctgtct
cagaaggtggccaccatgctgtccctggagtctgagttgcagcggctacaggaggtcagt
ggacaccagcgaaaacgaattgctgaggtgctgaacgggctgatgaaggacctgagtgag
ttcagtgtcatcgtgggcaacggggagattaaactgccagtggagatcagtggggccatt
gaggaggagtttaccgtggcccgactctacatcagcaaaatcaaatcggaggtcaagtct
gtggtcaagcggtgccggcagctggagaacctccaggttgaatgtcatcgcaagatggaa
gtgactgggcgggagctctcatcttgccagctcctcatctcccagcatgaggccaagatc
cgctcacttacagaatacatgcagagcatggagctcaagaaacggcacctagaagagtcc
tatgactccctgagtgatgaattggccaagctccaggcccaggaaacagtacatgaagtg
gccctgaaggacaaggagccagacacacaggatgcagacgaaatgaagaaggccctggag
ctacagatggagagtcaccgggaggcccaccaccggcagctggcccggctccgggatgag
atcaacgagaagcagaagaccatcgatgaactcaaagacctgaatcagaagctccagtta
gagctagagaagcttcaggctgactatgagaagctgaagaatgaagaacatgagaagagc
accaaactccaggagctgacatttctgtacgagcgacatgagcagtccaagcaggacctc
aagggtctggaggagacagttgcccgggaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcactcccaaaagcagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttagggctacggctgagagagttaaggccctggagggtgcactgaag
gaagccaaggagggcgccatgaaggacaagcgccggtaccagcaggaggtggaccgcatc
aaggaggctgttcggtacaagagctctggcaagaggggccattctgctcagattgccaaa
cccgtccgacctggccactacccagcatcttcacccaccaacccctatggtacccgaagc
cctgagtgcatcagttataccaacagcctcttccagaactaccagaatctgtacctgcag
cctgcacctagcaccacctcagatatgtactttgcaaactcctgtaccggcagtgggacc
atgtcttctggcagccccttggcttcctaccagaaggccaacatggacaatggaaacgct
acagatatcaatgacaataggagtgatctgccatgcggctatgaggctgaggaccaggcc
aagcttttccctctccaccaagagactgcggccagctaa

KEGG   Pteropus alecto (black flying fox): 102893034
Entry
102893034         CDS       T02993                                 

Gene name
KIF5C
Definition
(RefSeq) kinesin heavy chain
  KO
K10396  kinesin family member 5
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04144  Endocytosis
pale04728  Dopaminergic synapse
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102893034 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102893034 (KIF5C)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102893034 (KIF5C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102893034 (KIF5C)
   05012 Parkinson disease
    102893034 (KIF5C)
   05014 Amyotrophic lateral sclerosis
    102893034 (KIF5C)
   05016 Huntington disease
    102893034 (KIF5C)
   05020 Prion disease
    102893034 (KIF5C)
   05022 Pathways of neurodegeneration - multiple diseases
    102893034 (KIF5C)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102893034 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102893034 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pale04812]
    102893034 (KIF5C)
   04147 Exosome [BR:pale04147]
    102893034 (KIF5C)
Membrane trafficking [BR:pale04131]
 Others
  Actin-binding proteins
   Others
    102893034 (KIF5C)
Cytoskeleton proteins [BR:pale04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     102893034 (KIF5C)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102893034 (KIF5C)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 102893034
NCBI-ProteinID: XP_006921118
LinkDB
Position
Unknown
AA seq 957 aa
MADPSECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPSTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVI
QHLEMELNRWRNGEAVPEDEQISAKDQKTLEPCDNTPIIDNIAPVVAGISAEEKEKYDEE
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAA
KDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELS
NHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEES
QDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSR
LRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQA
REDLKGLEETVSRELQTLHNLRKLFVQDLTARVKKSVELDSDDGGGSAAQKQKISFLENN
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGGSSNSTHYQK
NT seq 2874 nt   +upstreamnt  +downstreamnt
atggcggatccatctgaatgcagcatcaaagtgatgtgccggttccggcccctcaacgaa
gcggagatcctccgcggggacaaattcatccccaaatttaaaggcgacgagaccgtggta
atcgggcaagggaagccatatgtcttcgacagagtgctgcctcccagcacgacccaagag
caggtgtacaatgcgtgtgcaaagcaaattgtcaaagatgtcctcgaaggttacaatggg
acaatttttgcatatggacagacttcatcgggaaaaacgcataccatggaggggaagctg
catgaccctcaactcatggggatcatcccaaggatcgcgcacgacatctttgaccatatt
tattccatggatgaaaacctggagtttcatatcaaggtttcctattttgagatctacttg
gacaaaatcagggacttactcgatgtatccaagacaaacttggctgttcatgaagataaa
aacagagtcccgtatgtaaaggggtgcactgagcggtttgtgtccagccccgaggaagtc
atggatgtgatagatgaaggcaaagcaaaccgacacgtggctgtaacaaacatgaatgaa
cacagctctagaagtcacagtatcttcctgattaatattaaacaagagaatgtagagact
gaaaaaaaactcagtgggaagctttatctagttgatttggctgggagcgaaaaggtcagc
aaaactggtgccgagggagctgttctcgacgaagctaaaaatatcaataaatctttgtct
gctcttggaaatgtgatctctgccttggcagaagggacaaaaactcatgtgccgtaccgg
gacagcaagatgactcggattcttcaggactctctgggtgggaactgtagaactaccatt
gtcatttgctgttctccttctgtcttcaacgaagctgagacgaagtcaacgctgatgttt
ggacaaagggctaaaactatcaagaatacagtctctgtgaacctggaactgaccgcggaa
gaatggaagaagaaatatgaaaaagagaaagagaaaaacaagactttgaagaatgttatc
cagcacctggagatggagctaaaccgatggagaaatggagaagctgtgcctgaggacgaa
cagatcagtgcgaaggaccagaagactctggagccctgtgataacacccccatcatcgac
aatattgcccctgttgttgctggcatctctgcggaggagaaagaaaagtatgatgaggag
atctccagtctctacagacagctggatgataaggatgatgaaattaaccagcagagccag
ctggctgaaaagctgaagcaacagatgttggatcaggatgagcttttagcttccacaaga
agagactatgagaagatccaagaggagctgacgcgtctccagattgaaaatgaggcagcc
aaagatgaggtgaaagaagttctccaggctctggaggagctggctgtcaattatgaccag
aagtcacaggaagtggaggacaagaccagggccaatgagcagctgacagatgagctggcc
cagaaaacgactacattgacaaccacacagagagagctgagccagctgcaagagcttagc
aaccaccagaaaaagagagctacagagatcctgaatttgttgttgaaggatctgggggag
ataggtggaattattggcaccaatgatgtgaagactttggcagatgtgaatggagtcatt
gaagaggagttcaccatggcccgtctgtacatcagtaagatgaagtcagaggttaagtcc
ctggtgaaccgcagcaaacagcttgagagtgcccagatggattccaacaggaagatgaat
gccagtgagcgagagctggcagcatgccagctgctcatatcccagcacgaagccaagatc
aagtccctgacagactacatgcagaacatggaacagaagaggaggcagttggaagagtcc
caagactcactcagtgaagagctggccaagctccgagcccaagaaaaaatgcatgaagtc
agcttccaggataaggaaaaggaacatctgacgcggctgcaggatgctgaggaaatgaag
aaggcgctggagcagcagatggagagccaccgggaggctcaccagaagcagctgtccagg
cttcgagatgaaattgaggagaagcagaaaatcattgatgagattcgggatttgaatcag
aaacttcaactggaacaagagaagctcagttctgattataacaagctgaaaatagaggac
caagagagagaaatgaaactggaaaagctgttattgctcaatgacaaaagggaacaagcc
agggaggacctcaaagggctggaagagacagtgtctcgggaactgcagactctgcacaac
ctccgtaaactcttcgtccaggatctgactgcccgggttaaaaaaagtgtagagctggac
agtgatgatggagggggcagtgctgcccagaagcagaaaatctccttcctagagaataac
ctggagcagctcacgaaggttcacaagcagctggtccgggacaacgcagacctgcgctgt
gagctgcccaagctggagaagcggctgcgtgccaccgcggagcgcgtcaaggctctggaa
agcgcgctgaaggaagccaaggagaacgccatgcgagaccgcaagcgctaccagcaggag
gtagatcgcatcaaggaggcagtgcgagccaagaacatggccaggagggcccactcggcc
cagatagccaagcccatccgccctggacactacccagcatcatctccaacagccgtccac
gccatccgaggaggaggaggcggctcttcaaactccactcactaccagaaataa

KEGG   Pteropus alecto (black flying fox): 102894324
Entry
102894324         CDS       T02993                                 

Gene name
KIF5B
Definition
(RefSeq) kinesin-1 heavy chain
  KO
K10396  kinesin family member 5
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04144  Endocytosis
pale04728  Dopaminergic synapse
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102894324 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102894324 (KIF5B)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102894324 (KIF5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102894324 (KIF5B)
   05012 Parkinson disease
    102894324 (KIF5B)
   05014 Amyotrophic lateral sclerosis
    102894324 (KIF5B)
   05016 Huntington disease
    102894324 (KIF5B)
   05020 Prion disease
    102894324 (KIF5B)
   05022 Pathways of neurodegeneration - multiple diseases
    102894324 (KIF5B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102894324 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102894324 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pale04812]
    102894324 (KIF5B)
   04147 Exosome [BR:pale04147]
    102894324 (KIF5B)
Membrane trafficking [BR:pale04131]
 Others
  Actin-binding proteins
   Others
    102894324 (KIF5B)
Cytoskeleton proteins [BR:pale04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     102894324 (KIF5B)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102894324 (KIF5B)
SSDB
Motif
Pfam: Kinesin Microtub_bd Crescentin
Other DBs
NCBI-GeneID: 102894324
NCBI-ProteinID: XP_006914531
LinkDB
Position
Unknown
AA seq 963 aa
MADPAECNIKVMCRFRPLNDSEVNRGDKYIAKFQGEDTVMIATKPYAFDRVFQSNTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEREKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFAVDKDVTITNDKPATTIGVTGNFTDAERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLSEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMMLEQERLRVEHEKLKVTDQEKSKKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFTQNSQPVAVRGGGG
KQV
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcggacccagccgagtgcaacatcaaagtgatgtgtcgcttcagacctctcaacgat
tctgaagtgaaccgcggcgataaatacatcgccaagtttcagggagaagacacggtcatg
atcgcgaccaagccttatgcatttgatagggtgttccagtcaaacacatctcaagagcaa
gtgtataatgactgtgcaaagaagattgttaaagatgtacttgagggatataatggaaca
atatttgcatatggacagacatcctctgggaagacacacacaatggagggtaaacttcat
gatccggaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatttatttggat
aagataagggacctattagatgtttcaaagaccaacctttcagttcatgaagataaaaac
cgagtaccatatgtaaagggatgcacagaacgttttgtatgtagtccagatgaagttatg
gataccatagatgaaggaaaatccaacagacatgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatttttcttattaatgtaaaacaagagaacacgcaaacggaa
caaaagctgagtggaaaactttatctggttgatttagctggtagtgaaaaggttagtaaa
actggagctgaaggtgctgtgctggatgaagctaagaacatcaacaagtcactttctgct
cttgggaatgtcatttctgctttggctgagggtagtacatatgttccatatcgagatagt
aaaatgacaagaatccttcaagattcattaggcgggaactgtagaaccactattgtaatt
tgctgctctccatcatcatacaatgaatctgaaacaaaatctacactcctgtttggccaa
agggccaaaacaattaagaacacagtttgtgtcaatgtagagttaactgcagaacaatgg
aaaaagaagtatgaaagagaaaaagaaaaaaataagaccctacggaacaccattcagtgg
cttgaaaatgaactcaaccggtggcgtaatggagagacagtgcctattgatgaacagttt
gacaaagagaaagccaacttggaagctttcgcagtggataaggatgttactattaccaat
gataaaccagcaaccacgattggagttactggaaactttactgatgctgaaagaagaaag
tgtgaagaagaaattgctaaattgtacaaacaactagatgacaaggatgaggaaattaat
cagcagagccaattggtagagaaattgaagacacagatgttggatcaggaagaacttctg
gcatctaccagaagagatcaagataatatgcaagctgagctgaatcgccttcaagcagaa
aacgatgcctcaaaagaagaagtaaaagaagttttacaagccttggaggaacttgctgtt
aattatgatcagaagtctcaagaagttgaagacaaaactaaggaatatgaattacttagt
gatgaactgaatcagaaatcggcaactttagcaagtatagatgctgaacttcagaaactt
aaggaaatgaccaaccaccagaaaaaacgagcagctgagatgatggcatctttactaaaa
gaccttgcagaaataggaattgctgtaggaaataatgacgtgaagcagcctgagggaact
ggcatgatagatgaagaattcactgttgcaaggctctatattagcaaaatgaagtcagaa
gtaaaaacaatggtaaaacgctgcaaacagttggagagcacacaaactgagagcaacaaa
aaaatggaagaaaatgaaaaggagttagcagcatgccagcttcgtatctctcaacatgaa
gccaaaatcaagtcattgactgaataccttcaaaatgtggaacaaaagaaaagacagcta
gaggaatctgttgattccctcagtgaagaactagttcagcttcgagcacaagagaaagtc
catgaaatggaaaaggagcacttaaataaggttcagactgcaaatgaagttaagcaagct
gttgaacagcagatccaaagccacagagaaactcatcagaaacaaattagtagcttgaga
gatgaagttgaggcaaaagaaaaacttattactgatcttcaagaccaaaaccagaaaatg
atgttagagcaggaacgtctgagagtagaacatgagaagttgaaagttacagatcaggaa
aagagcaaaaaattacatgaactcacggttatgcaagatagacgagaacaagcaagacaa
gacttgaagggtttggaagagacagtggcaaaagaacttcagactttacataacctgcgg
aagctctttgttcaggacctggccaccagagttaaaaagagtgcagaaatcgattctgat
gacactggaggcagtgctgctcaaaagcaaaagatctcatttcttgaaaataatctcgaa
caactcactaaagtgcacaagcagttggtacgtgataatgcagatcttcgctgtgaactt
cccaagttggaaaagagacttagagctacagctgagagagtgaaagctctggagtcagca
ctgaaagaagccaaagaaaatgcatctcgtgatcgcaaacggtatcagcaagaagtagat
cgtataaaggaagcagtcaggtcaaagaatatggccagaagaggacattcagcacaaatt
gctaaacctattcgtcctgggcaacatccagcagcttctccaactcatccaagtgcaatt
cgcggaggaggtgcgtttactcagaacagccagccagtggcagtacgaggtggaggcggc
aaacaagtgtaa

DBGET integrated database retrieval system