KEGG   Pteropus alecto (black flying fox): 102878191
Entry
102878191         CDS       T02993                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04064  NF-kappa B signaling pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04218  Cellular senescence
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102878191 (GADD45G)
   04064 NF-kappa B signaling pathway
    102878191 (GADD45G)
   04068 FoxO signaling pathway
    102878191 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102878191 (GADD45G)
   04210 Apoptosis
    102878191 (GADD45G)
   04115 p53 signaling pathway
    102878191 (GADD45G)
   04218 Cellular senescence
    102878191 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878191 (GADD45G)
   05202 Transcriptional misregulation in cancer
    102878191 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102878191 (GADD45G)
   05212 Pancreatic cancer
    102878191 (GADD45G)
   05225 Hepatocellular carcinoma
    102878191 (GADD45G)
   05226 Gastric cancer
    102878191 (GADD45G)
   05214 Glioma
    102878191 (GADD45G)
   05216 Thyroid cancer
    102878191 (GADD45G)
   05220 Chronic myeloid leukemia
    102878191 (GADD45G)
   05217 Basal cell carcinoma
    102878191 (GADD45G)
   05218 Melanoma
    102878191 (GADD45G)
   05213 Endometrial cancer
    102878191 (GADD45G)
   05224 Breast cancer
    102878191 (GADD45G)
   05222 Small cell lung cancer
    102878191 (GADD45G)
   05223 Non-small cell lung cancer
    102878191 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102878191 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102878191 (GADD45G)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102878191 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102878191 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102878191
NCBI-ProteinID: XP_006923464
UniProt: L5JWR6
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEVRCQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEAGAPGDLHCI
LISNPNEDSWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgctgccaggacacggttcctgagagcacagccaggatgcag
ggagctggaaaagcgctgcacgagctgttgctgtcggcgcagcgccagggctgcctcact
gctggcgtctacgagtccgccaaagtcctgaacgttgacccagacaacgtgaccttttgc
gtgctggccgccgatgaggaggacgagggcgacatcgcgctgcagatccacttcacgctg
attcaggcgttctgctgcgagaatgacatcgacatcgtgcgtgtgggcgacgtgcagcgg
ctggcggccatcgtgggcgccggtgacgaggcgggtgcgccgggagacctgcactgcatc
ctcatttcgaaccccaatgaggactcgtggaaggaccccgccttggagaagctcagcctg
ttttgcgaggagagccgcagtgtcaacgactgggtgcccagtatcaccctccccgagtga

KEGG   Pteropus alecto (black flying fox): 102885790
Entry
102885790         CDS       T02993                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04064  NF-kappa B signaling pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04218  Cellular senescence
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102885790 (GADD45B)
   04064 NF-kappa B signaling pathway
    102885790 (GADD45B)
   04068 FoxO signaling pathway
    102885790 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102885790 (GADD45B)
   04210 Apoptosis
    102885790 (GADD45B)
   04115 p53 signaling pathway
    102885790 (GADD45B)
   04218 Cellular senescence
    102885790 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885790 (GADD45B)
   05202 Transcriptional misregulation in cancer
    102885790 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102885790 (GADD45B)
   05212 Pancreatic cancer
    102885790 (GADD45B)
   05225 Hepatocellular carcinoma
    102885790 (GADD45B)
   05226 Gastric cancer
    102885790 (GADD45B)
   05214 Glioma
    102885790 (GADD45B)
   05216 Thyroid cancer
    102885790 (GADD45B)
   05220 Chronic myeloid leukemia
    102885790 (GADD45B)
   05217 Basal cell carcinoma
    102885790 (GADD45B)
   05218 Melanoma
    102885790 (GADD45B)
   05213 Endometrial cancer
    102885790 (GADD45B)
   05224 Breast cancer
    102885790 (GADD45B)
   05222 Small cell lung cancer
    102885790 (GADD45B)
   05223 Non-small cell lung cancer
    102885790 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102885790 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102885790 (GADD45B)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102885790 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102885790 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102885790
NCBI-ProteinID: XP_006904137
UniProt: L5L6T4
LinkDB
Position
Unknown
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEGDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPDEAQGTAEARDLHCL
LVTNPHTDAWKSQGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaccctggaagagctggtggcgtgcgacaacgcggcgcagaagatgcagaccgtgagc
gccgcggtggaggagctgttggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagcgtggtcctgtgcctcttggcc
atcgacgaggaggaggagggcgacatcgccctgcagatccacttcacgctcatccagtcc
ttttgctgcgacaacgacatcgacatcgtccgggtgtccggcatgcagcgcctggcgcag
ctgctgggcgagccagacgaggcccagggcaccgccgaggcccgggacctgcactgcctc
ctggtcacgaacccgcacacggacgcctggaagagccagggcctggtggaggtggccagt
tactgcgaagagagccgggggaacaaccaatgggtcccctacatctccctccaggagcgc
tga

KEGG   Pteropus alecto (black flying fox): 102886440
Entry
102886440         CDS       T02993                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04064  NF-kappa B signaling pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04218  Cellular senescence
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102886440 (GADD45A)
   04064 NF-kappa B signaling pathway
    102886440 (GADD45A)
   04068 FoxO signaling pathway
    102886440 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102886440 (GADD45A)
   04210 Apoptosis
    102886440 (GADD45A)
   04115 p53 signaling pathway
    102886440 (GADD45A)
   04218 Cellular senescence
    102886440 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102886440 (GADD45A)
   05202 Transcriptional misregulation in cancer
    102886440 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102886440 (GADD45A)
   05212 Pancreatic cancer
    102886440 (GADD45A)
   05225 Hepatocellular carcinoma
    102886440 (GADD45A)
   05226 Gastric cancer
    102886440 (GADD45A)
   05214 Glioma
    102886440 (GADD45A)
   05216 Thyroid cancer
    102886440 (GADD45A)
   05220 Chronic myeloid leukemia
    102886440 (GADD45A)
   05217 Basal cell carcinoma
    102886440 (GADD45A)
   05218 Melanoma
    102886440 (GADD45A)
   05213 Endometrial cancer
    102886440 (GADD45A)
   05224 Breast cancer
    102886440 (GADD45A)
   05222 Small cell lung cancer
    102886440 (GADD45A)
   05223 Non-small cell lung cancer
    102886440 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102886440 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102886440 (GADD45A)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102886440 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102886440 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102886440
NCBI-ProteinID: XP_006919368
UniProt: L5K3V3
LinkDB
Position
Unknown
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDASPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcaaaagaccgaaaggatggataaggtgggg
gatgccctcgaggaagtgctaagcaaagccctgagtcagcgcaccatcacggtcggggtg
tatgaggcggccaagctgctcaatgttgacccggataacgtagtgctgtgtctgctggcc
gcggacgaggacgacgacagggatgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgtgagaacgacatcaacatcctgcgcgtcagcaaccccggccggctggctgag
ctcctgctcctagagacggacgcgagccccgcggcgagcgagggggcagagcagcccccg
gacctacactgcgtgttggtgacgaatccacattcatcacaatggaaggatcccgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

DBGET integrated database retrieval system