KEGG   Pteropus alecto (black flying fox): 102878233
Entry
102878233         CDS       T02993                                 

Gene name
LRP6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04150  mTOR signaling pathway
pale04310  Wnt signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05200  Pathways in cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102878233 (LRP6)
   04150 mTOR signaling pathway
    102878233 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    102878233 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878233 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102878233 (LRP6)
   05226 Gastric cancer
    102878233 (LRP6)
   05224 Breast cancer
    102878233 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102878233 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    102878233 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102878233 (LRP6)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    102878233 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 102878233
NCBI-ProteinID: XP_006912686
UniProt: L5KJX6
LinkDB
Position
Unknown
AA seq 1613 aa
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAVALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNVIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDEVECYPTEEPTPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPGSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagtttctgcgtgctcctgagagcggcc
cctttgctgctttatgcaaacagacgggacttacgattggttgatgctacaaatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagctgcagtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagagttt
aacaaaactgagagtgtacagaatgttgttgtttccggattattgtcacccgatgggttg
gcatgtgattggcttggagaaaagttatactggacagattctgaaactaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccg
agagctgttgccttagatccttcaagtgggttcatgtactggacagactggggagaagta
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattataataaacactgaa
atttactggccaaatggactgactttggattatgaggaacagaaactttattgggcagat
gcaaaacttaatttcatccataaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttatttgaggacacattgtactggact
gattggaatacacactccattttggcttgcaacaagtacactggcgagggtctgcgtgaa
atccactctaacatcttctctcccatggatatacatgccttcagccaacagaggcagcca
aatgctacaaatccatgtggaattgataatggtggttgttcccacttgtgtttgatgtct
ccagtcaagcctttttatcaatgtgcttgcccgactggggtcaaactcctggagaatgga
aaaacctgcaaagatggtgccactgaattgttgcttttagcccgaaggacagacttgaga
cgcatttctttggatacaccagacttcacagacattgttctacagttagaagacatccgt
catgccattgcgatagattatgaccctgtggaaggctatatctactggactgacgatgaa
gtgagggccatacgccgctcattcatagatggatctggcagtcagtttgtggtcactgct
caaattgcgcatcctgatggtattgctgttgactgggttgcccgaaatctttattggaca
gacactggcactgatcggatagaagtgacaaggctcaatggcaccatgaggaagatcttg
atttcagaggacttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaatcccgaaaattgagcgagcagctctggatggttctgac
cgagtagtgttggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaaaattgaggttatgaataccgat
ggcactgggagacgagtactagtggaagacaaaattcctcacatatttgggtttactttg
ttgggtgactatgtttactggactgactggcagaggcgtagcatcgaaagagtacacaaa
cgaagcgcagagagggaaatcatcatagatcagctccctgacctcatgggcttaaaggcc
acaaatgttcatagaatcattggttccaacccctgcgctgaggaaaatgggggatgtagc
catctttgcctctatagacctcagggacttcgctgtgcctgtcccattggctttgaactc
atcagtgacatgaagacctgcattgtcccagaggcttttcttttgttttcacggagagca
gatatcaggagaatttctttggaaactaacaataataatgtagccattccgctcactggt
gtcaaagaagcttctgctttggattttgatgtgacagacaaccgaatttactggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcactggaacatgtggta
gagttcggcttagattatccagaaggcatggcagtggactggcttgggaagaacttgtac
tgggcagacacaggaacgaatagaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtgtggaaagacctagatagtcccagagctcttgcgttggaccctgctgaagga
tttatgtattggactgagtggggtggaaaacctaagatagacagagctgccatggatgga
agtgaacgtactacattagttccgaacgtggggcgtgcaaatggcctaactattgattat
gctaaaaggaggctctattggacagacctggacaccaacttaatagaatcttcaaatatg
cttggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattacatctattggacggactggagccgacgcagcattgaacgtgccaacaaa
actagtggccaaaaccgcaccatcattcagggccatttggattatgtgatggacatcctc
gtctttcattcctctcggcaggcaggatggaatgagtgtgcttccagcaatgggcactgc
tcccatctctgcttggctgtgccagttggaggttttgtttgtggatgccctgcccactac
tctcttaattctgacaacaggacttgtagtgctccaactactttcctgctcttcagtcag
aagagtgccattaaccgcatggtgattgatgaacaacagagccctgatatcatccttccc
attcacagccttcgaaatgtccgggccattgactatgacccactggacaagcaactgtat
tggattgactcacgacaaaatgtgatccgaaaagcacaagaagatggtagccagggcttt
actgtggtggtgagctcagttcctaatcagaacctagaaatacaaccctatgacctcagc
attgatatttatagccgctatatctactggacttgtgaggctaccaatgtcatcaacgta
acaaggttagatggaagatcaattggagtggtgctaaaaggcgagcaagacagacctcga
gccattgtggtaaacccagagaaaggatatatgtattttaccaatcttcaggaaagatct
cctaaaattgaacgagctgctttggatggaacggaacgagaggtcctctttttcagtggc
ttaagtaaaccaattgctttagcccttgatagccgattgggcaaactcttttgggctgat
tcagatctccgacgaattgaaagcagtgatctctcaggtgccaaccggatagtattagaa
gactccaatatcttgcagcctgtgggactgactgtgtttgaaaattggctatattggatt
gataagcagcagcaaatgattgaaaaaattgacatgacaggtcgagagggtagaactaaa
gtccaggctcgaattgcccagcttagtgatattcatgcagtaaaggagctgaaccttcag
gaatatagacaacatccttgtgctcaggataatggtggctgttcacatatttgtcttgta
aaaggagatggtactacaagatgctcttgccccatgcacttggttctgcttcaggatgag
ctgtcatgtggagaacccccaacatgttctcctcagcagtttacctgtttcacgggagaa
attgactgtatccctgtagcttggcgttgcgatggatttactgaatgtgaagaccatagt
gatgagctcaattgtcctgtgtgctcagagtcccagttccagtgtgccagtgggcagtgt
attgatggtgccctccgatgcaatggagatgcaaactgccaggataaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagtttcgctgtgccaatggtcagtgcattgga
aaacataagaaatgtgatcataatgtggattgcagtgacaaatcagatgaagtggaatgt
tatccaactgaggagccaacaccacaggccactaatacagttggttcagttattggagtc
attgtcaccattttcgtgtctggaaccatatactttatctgccagaggatgttgtgtcca
cgtatgaagggagatggggaaaccatgactaatgactatgtagttcatggaccagcttcc
gtgccccttggttatgtgccacacccaggttctttatcaggatctcttccaggaatgtct
cgaggtaaatcaatgatcagctcccttagtatcatggggggaagcagcggacccccttat
gaccgagctcatgtcacaggagcatcatcaagtagttcttcaagcaccaaaggcacttac
ttccctgcaattttgaaccctccaccatccccagccacagagcgatcacattacactatg
gaatttggttattcttcaaacagtccttccactcataggtcctacagctacaggccatac
agttaccggcactttgcaccccccaccacaccctgcagcacagatgtttgtgacagtgac
tatgctcccagccggagaatgacctcagtggcaacagccaagggctacactagtgacttg
aactatgactcagagcctgtgcccccacctcccacaccccgaagccaatacttgtcagca
gaagagaactatgaaagctgcccaccttctccatacacagagaggagctactctcatcac
ctctacccaccaccaccctctccctgtacagactcctcctga

KEGG   Pteropus alecto (black flying fox): 102894479
Entry
102894479         CDS       T02993                                 

Gene name
LRP5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04150  mTOR signaling pathway
pale04310  Wnt signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05200  Pathways in cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102894479 (LRP5)
   04150 mTOR signaling pathway
    102894479 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    102894479 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102894479 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102894479 (LRP5)
   05226 Gastric cancer
    102894479 (LRP5)
   05224 Breast cancer
    102894479 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102894479 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    102894479 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102894479 (LRP5)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    102894479 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD DUF5653 cEGF
Other DBs
NCBI-GeneID: 102894479
NCBI-ProteinID: XP_015444303
LinkDB
Position
Unknown
AA seq 1451 aa
MYWTDWGETPRIERAGMDGSTRKVIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILGALYSPMDI
QVLSPERQPYFHTQCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVMQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVARLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECADLDGQERHVLVNTSLGWPNGLALDLQEGKVYWGDAKT
DKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIVPE
AFLVFTSRAAIHRISLETSSNDVAIPLTGVKEASALDFDVSSGHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQGRVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLVQG
HLDFVMDLLVFHASRQDGLNDCVHSNGQCGQLCLAIPGGRRCSCASHYTLDPSGRNCSPP
STFLLFSQKNAISRMIPDDQHSPDLMLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGTQPSILTSPSPNQNPDRQPHDLSIDVYSRTLFWTCEATNTINVHRLNGDAMGVVLRG
DRDKPRAIVVNAERGYLYFTNMQEPAAKIERTALDGTEREVLFTTGLIRPVALVVDNALG
KLFWVDADLKRIESCDLSGANRLTLEDANVVQPVGLAVLGRHLYWIDRQQQMIERVEKTS
GDKRTRVQGRVAHLTGIHAVEDVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFP
CARGQCVDLRLRCDGEADCQDRSDEADCDAICLPSQFRCASGQCVLIKQQCDSFPDCVDG
SDELMCEISKPPSDDTPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYTGASGPFPH
EYVSGTPHVPLNFIAPGASQHGPFTGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNVDTFYSSSVPAPARPYRPYIIRGMAPPTTPCS
TDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLF
PPPPSPCTDSS
NT seq 4356 nt   +upstreamnt  +downstreamnt
atgtactggacagactggggtgagacaccccgaatcgagcgggcagggatggatggcagc
acccggaaagtcattgtggactcggacatttactggcccaacgggctgaccatcgacctg
gaggagcagaagctttactgggccgatgccaagctcagcttcatccatcgtgccaacctg
gacggctcgttccggcagaaggtggtggagggcagcctgacgcacccctttgccctgacg
ctctctggggacactctgtactggaccgactggcagacgcgctccattcacgcctgtaac
aagaggacgggggagaagcggagggagattctcggtgctctctactcgcccatggacatt
caagtgctcagcccggagcggcagccgtacttccacacgcagtgcgaggaagacaacgga
ggctgctcccacctgtgcctgctgtccccgagggagcctttctacacgtgcgcctgcccc
acgggcgtgcagctccaggacaacggcaagacgtgcaaggcaggggccgaggaggtgctg
ctgctggcccggcggacggacctgcggaggatctcactggacacgccggacttcacggac
atcgtgatgcaggtcgatgacatccggcacgccatcgccatcgactacgacccgctggag
ggctacgtctactggacggacgacgaggtgcgggccatccgcagggcgtacctggacggg
tcgggggcacagacgctggtcaacaccgagatcaacgaccccgatggcatcgccgtcgac
tgggtggcccgaaacctctactggacggacacgggcactgaccgcatcgaggtggcacgc
ctcaacggcacctcccgcaagattctggtgtccgaggacctggacgagccccgcgccatc
gtgctgcaccccgtcatgggcctcatgtactggacggactggggggaaaaccccaaaatc
gagtgtgccgacctggatgggcaggagcggcacgtgctggtgaacacctccctcggctgg
cccaatggcttggccctggacctgcaagagggcaaggtgtactggggagacgccaagacg
gacaagattgaggtgatcaatgtcgacgggacaaagaggcggacgctgctggaggacaag
ctcccgcacattttcgggttcacgctgctgggggacttcatctactggaccgactggcag
cggcgcagcatcgagcgtgtgcacaaggtcaaggccagccgggatgtcatcatcgaccag
ctgccggacctgatggggctcaaggccgtgaacgtggccaaggtcgtcggaaccaacccc
tgtgcggacaggaacggggggtgcagccacctgtgcttcttcacgccccacgcgaccaag
tgcggctgccccatcggcctggagctgctgagtgacatgaagacctgcattgtccccgag
gccttcctcgtgttcaccagcagagccgccatccacaggatctcccttgagaccagcagc
aacgacgtggccatccctctcacgggcgtcaaggaggcctccgcgctggactttgatgtg
tccagtggtcacatctactggacggacgtcagcctcaagaccatcagccgcgccttcatg
aacgggagctcggtggagcacgtgatcgagtttggcctcgactacccggaaggcatggct
gttgactggatgggcaagaacctctactgggcagacactgggaccaacaggatcgaagtg
gcccggctggacgggcagttccggcaggtcctcgtgtggagggacttggacaacccgagg
tcgctggccctggaccccaccaaaggctacatctactggaccgagtggggtggcaagccg
aggatcgtgcgggctttcatggacgggaccaactgcatgacgctggtggacaaggtgggc
cgggccaatgacctcaccatcgactacgccgaccagcgtctctactggactgacctggac
accaacatgatcgagtcatccaacatgctgggtcaggggcgggtcgtgatcgccgatgac
ctcccgcaccccttcggcctgacgcagtacagtgactacatctactggacagactggaac
ctccacagcatcgagcgggccgacaagaccagcggccggaaccgtaccctcgtccagggc
cacctggacttcgtgatggacctcctggtgtttcatgcctcccgccaggatggcctcaac
gactgcgtgcacagcaacgggcagtgtgggcagctgtgcctcgccatccccgggggccgc
cgctgcagctgtgcctcgcactacaccctggaccccagcggccgtaactgcagcccgccc
agcacctttttgctgttcagccagaaaaatgccatcagccggatgatcccagatgaccag
cacagcccggacctcatgctgcccctgcacgggctgcggaacgtcaaagccattgactac
gacccgctggacaagttcatctactgggtggatgggcgccagaacatcaagcgggccaag
gacgacgggacccagccgtccattctgacctctccgagcccgaaccagaacccggacagg
cagccccacgatctcagcatcgacgtctacagccggacactgttctggacgtgcgaggcc
accaacaccatcaacgtccaccggctgaatggggacgccatgggcgtggtgcttcgtggg
gaccgcgacaagccgagggctatcgtcgtcaacgccgagcgagggtacctgtacttcacc
aacatgcaggagccggcggccaagatcgagcgcacggccctggacggcaccgaacgtgag
gtcctctttaccactggcctcatccgccctgtggccctcgtggtggacaacgcgctgggc
aagctcttctgggtggacgcggacctgaagcgcatcgaaagctgcgacctgtcaggggcc
aaccgcctgacactggaggacgccaacgtcgtgcagcccgtgggcctggccgtgctgggc
aggcacctgtactggatcgaccgccagcagcagatgatcgagcgcgtggagaagaccagc
ggggacaagcgaacacgagtccagggccgcgtcgcccacctgaccggcatccacgccgtg
gaggacgtcagcctggaggagttctcggcccacccatgtgcccgggacaatggcggctgc
tcccacatctgcattgccaagggtgacgggacaccacggtgctcgtgcccagtgcacctg
gtgcttctgcagaacctgctgacctgtggcgagcctcccacctgctcccccgaccagttc
gcctgtgccacgggggagatcgactgcatccccggggcctggcgctgcgacggtttccct
gagtgtgacgaccagagcgacgaggagggttgtcccgtgtgctcggccgcccagttcccc
tgcgcgcggggccagtgcgtggacctgcgactgcgctgcgacggcgaggccgactgccag
gaccgctccgacgaagctgattgcgatgccatctgcctgcccagccagttccggtgcgcc
agcggccagtgcgtgctcatcaagcagcagtgcgactccttccccgattgtgttgacggc
tccgatgagctgatgtgtgaaatctccaagccaccctccgacgacaccccagcccacagc
agcgccatcgggcccgtcatcggcatcatcctctcactcttcgtcatgggtggcgtctac
ttcgtgtgccagcgtgtggtgtgtcagcgctacacaggggccagcgggcccttcccacat
gagtatgtcagcgggaccccccacgtgcccctcaatttcatagccccaggtgcctcgcaa
catggtcccttcacaggcatctcatgtggcaagtccatgatgagctccgtgagcctgatg
ggtggccggggcggggtgcctctctacgaccggaaccatgtcaccggggcctcgtccagc
agctcatccagcaccaaggccacactgtacccgccgatcctgaaccccccaccgtcccct
gccacggacccctccctgtacaacgtggacacgttctactcttcaagcgttcccgccccc
gccaggccgtacaggccttacatcatccgtggtatggcacccccgaccacaccttgcagc
acagacgtgtgcgacagtgactacagtgccagccgctggaaggccagcaagtactacctg
gacttgaactcagactcagacccctacccgcccccgcccacaccccacagccagtacttg
tctgcggaggacagctgcccgccctcgcccgccaccgagaggagctacttccacctcttc
ccacccccgccgtccccctgcacagactcgtcctga

DBGET integrated database retrieval system