KEGG   Pteropus alecto (black flying fox): 102878242
Entry
102878242         CDS       T02993                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102878242 (IL3RA)
   04151 PI3K-Akt signaling pathway
    102878242 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102878242 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102878242 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102878242 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878242 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pale04050]
    102878242 (IL3RA)
   04090 CD molecules [BR:pale04090]
    102878242 (IL3RA)
Cytokine receptors [BR:pale04050]
 Interleukin receptor families
  IL3 receptor family
   102878242 (IL3RA)
CD molecules [BR:pale04090]
 Proteins
  102878242 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 102878242
NCBI-ProteinID: XP_024905531
LinkDB
Position
Unknown
AA seq 365 aa
MKCEASNYTVHVTLRDGSVFSTWIQYLEQEGEPGSAAEHLDCWVHDVHVLTCSWQVGREA
PRDVQYHLYLENAPGHGPRLIAKRALGYRSTEQRWPCPQYTANDQGTYVQCRFGNISGFA
STQYRLLVNGTSKDSRIRCSELVTPLSYIEKLTAPNMTGSCNESDSIMEWKMSSHLNTNF
NYELEIQKGTDAPYIQKVSVPCPGRPEHREGDEPRVSELALPSPQSQTLLPTEVWKTSFV
LSSPRVYTARIRALVSDLPPGQWSAPQRFVLVLAVRRPQDPRRLQCCPFPLRHCGPRRSR
LGLRPTCRNFSSRRCSVQHKLFPPIPRTKNPLSDDTQDEKMINWEGSRAGQEECPVADVQ
VLGET
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaaatgcgaagcgtcaaactacaccgtccacgtcaccctgagggacggctccgtgttc
tccacgtggattcagtacctggagcaagaaggggagcctgggtcggcggccgaacacctg
gactgctgggtgcacgacgtccacgtcctgacgtgcagctggcaggtgggcagggaggcc
ccgagggacgtccaatatcacttgtacctggagaatgctcccgggcacgggccccggctc
atcgctaaacgtgcccttggttaccgcagcactgagcagcggtggccgtgtccacagtac
acagccaacgaccaggggacatacgtccagtgtcgcttcggtaacatctctgggttcgcc
agcacccaataccgcttactggtgaacggaaccagcaaggactccagaatacgctgctcg
gaactcgtcacccctttgtcctacatcgagaaactgactgcacccaacatgacgggcagc
tgtaatgagtccgactctatcatggaatggaagatgtcaagccacctaaatacgaacttc
aactatgaactcgaaatacaaaagggcacagacgccccctacatacagaaggtgagtgtc
ccctgcccgggccgccctgagcatcgcgaaggggacgagccccgggtgtcagagctggcg
ctccccagcccacagagccagacgctgctgcccacggaggtgtggaagacatccttcgtg
ctgagcagcccccgcgtgtacacggcgaggatcagagcgctggtctccgacctgcccccc
ggccagtggagcgccccccagcgcttcgtgctcgttcttgcggtgcggagacctcaggac
cccaggaggctccagtgctgtcccttccccctgcgacactgtggcccccgcaggagccgg
ctggggctgcgtccgacttgcaggaacttctcttcacgcaggtgctcggtgcagcacaag
ctcttccctcccatcccccgcacgaaaaaccccctcagcgacgacactcaggacgagaag
atgattaactgggagggcagcagagctggccaggaggagtgtcccgtggctgacgtgcag
gtcttgggggaaacgtag

DBGET integrated database retrieval system