KEGG   Pteropus alecto (black flying fox): 102878456
Entry
102878456         CDS       T02993                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00220  Arginine biosynthesis
pale00330  Arginine and proline metabolism
pale01100  Metabolic pathways
pale04020  Calcium signaling pathway
pale04066  HIF-1 signaling pathway
pale04146  Peroxisome
pale04371  Apelin signaling pathway
pale04926  Relaxin signaling pathway
pale05010  Alzheimer disease
pale05014  Amyotrophic lateral sclerosis
pale05022  Pathways of neurodegeneration - multiple diseases
pale05133  Pertussis
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05145  Toxoplasmosis
pale05146  Amoebiasis
pale05152  Tuberculosis
pale05200  Pathways in cancer
pale05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102878456 (NOS2)
   00330 Arginine and proline metabolism
    102878456 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102878456 (NOS2)
   04066 HIF-1 signaling pathway
    102878456 (NOS2)
   04020 Calcium signaling pathway
    102878456 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102878456 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102878456 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878456 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102878456 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102878456 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102878456 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    102878456 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102878456 (NOS2)
   05152 Tuberculosis
    102878456 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102878456 (NOS2)
   05145 Toxoplasmosis
    102878456 (NOS2)
   05140 Leishmaniasis
    102878456 (NOS2)
   05142 Chagas disease
    102878456 (NOS2)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102878456 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102878456
NCBI-ProteinID: XP_015454627
LinkDB
Position
Unknown
AA seq 1157 aa
MASLWKFLFKARSYQYDLTKERDINNNMGKAIQAPSSPVTQDDTKRHSLGKHQNEDPQPF
LGTVKKSPESLVKLGAPPSACPRHVRIKNWGSGVTFQDTLHHKAKGDLACKSKCCLGAIM
NPKSLTRGPRDKPTSPDELLPQAIEFVNQYYSSFKESKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNI
RSAITVFPQRSDGKHDFRVWNSQLIRYAGYQMPDGTIRGDPACVEFTQLCIDLGWKPKYG
RFDVLPLVLQADGHDPEFFEIPPDLVLEVPMEHPKYEWFQELELKWYALPAVSNMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLTSLWKDQAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWVWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEPWKTHVWQDEKRRPQRREIRFQVLVKAVLFTSMLMRKTMASRVRAT
VLFATETGKSETLARDLGALFSCAFNPKVLCMDEYRLSSLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLTPTGEGD
ELSGQEEAFRSWAVQTFKAACETFNVRGKQHIQIPKLYTTNVTWDPNHYRLVQDSQPLDL
NKALSSMHAKNVFTLKLKSQQNLQSRKSSRTTLLVELSCEGSQDLSYLPGEHLGVFPSNQ
LALVQGILERVVDSPAPHQPMRLENLSETGSYWVRDKRLPPCSLNQALTYFLDITTPPTQ
LLLRKLAQLALEEAERQKLEALCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSATFLLSQL
PILKPRYYSISSSRDHTPTEIHLTVAVLTYRTQDGQGPLHHGVCSTWLSSLKPQDSVPCF
VRSANGFQLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDAEHRGVQGGRMILLFGCRHPD
EDHLYQEEMLEMARKGVLHGVHTAYSRLPGQPKVYVQDILRQQLASEVLRVLHEEQGHLY
VCGDVRMARDVAHTLKKLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AAGQPSNIRAPTDQRRI
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctctctttggaagtttctgttcaaggccagatcataccagtatgacttgacgaag
gaacgagacatcaacaacaacatggggaaagccatccaggctccctccagtccagtgacg
caggatgacaccaagcgccacagcctcggcaagcaccagaatgaggacccccagcccttc
ttggggacagtaaagaagtctccagaatccctggtcaagctgggtgcacccccatcggcc
tgcccacggcacgtgaggatcaaaaactggggcagtggggtgactttccaagatacactt
caccacaaagccaaaggggatcttgcttgcaagtccaagtgttgcctgggagccatcatg
aaccccaaaagtttgaccagaggacccagggacaagcctacctccccagacgagcttcta
cctcaagctatcgagtttgtcaaccagtattatagctccttcaaagagtcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatctttgccaccaagcaggcctggcgcaatgccccccgctgc
atcgggaggatccagtggtccaacctacaggtcttcgatgcccggagctgttctactgcc
caggaaatgttcgagcatatctgcagacacctgcgctatgccaccaacaatggcaacatc
aggtcggccatcaccgtgttccctcagcggagtgatgggaaacacgacttccgggtctgg
aattcgcagctcatccgctatgctggttaccagatgcctgatggtaccatcagaggggac
cctgcctgcgtggagttcacccagctgtgcatcgacctgggctggaagccgaagtacggc
cgcttcgatgtgttgcctctggtcctgcaggctgatggccatgaccctgagttctttgaa
atcccgcctgaccttgtgctcgaggtgcccatggaacatcccaagtacgagtggttccag
gaactggagctcaagtggtatgccctgcctgccgtgtccaatatgctgcttgaggtgggt
ggccttgagttcccagggtgccctttcaacggctggtacatgggcacagagatcggggtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcagaaggatgggc
ctagaaacacacaagttgacctcactctggaaagaccaggctgtcattgagatcaatgtc
gctgtgctccacagtttccagaagcaaaatgtgaccatcatggatcaccactctgctgca
gagtccttcatgaagtacatgcagaacgagtaccggtcccgagggggctgcccagccgac
tgggtttggctggtccccccaatttctggaagcatcactcccgtgttccaccaggagatg
ttaaactacgtgctgtcccctttctactactaccaggtggagccctggaaaacccatgtc
tggcaggatgagaagcggagaccccagagaagagagattcgattccaagtcttggttaaa
gccgtgctgttcacctccatgctgatgcgcaagaccatggcatcccgagtcagagccaca
gtcctttttgcgacggagacaggaaaatcagaaaccctggcccgggacctaggggccttg
ttcagctgtgccttcaaccccaaggttctctgcatggatgagtacaggctgagcagcctg
gaggaggagcagctgcttctggtggtgaccagtacatttgggaatggagactcccctggc
aatggagagaaactgaagaaatccctcttcatgttgaaagagctcaccaacaagttcagg
tatgctgtgtttggcctcggttccagcatgtaccctcagttctgcgcctttgctcatgat
atcgaccagaagttgtcccacctgggagcctctcagctcaccccgacaggggaaggggac
gaactcagtgggcaggaggaggccttccgcagctgggctgtgcaaaccttcaaggcagcc
tgtgagacattcaacgtccgaggcaaacagcacattcagatccccaagctctacaccacc
aatgtgacctgggacccgaaccactacaggcttgtgcaggactcacagcctttggacctc
aacaaagccctcagcagtatgcacgccaagaatgtgttcaccttgaagctcaaatcgcag
cagaatctacagagtcggaagtccagccgcaccaccctcctggtggaactctcctgcgag
ggcagtcaagatctcagctacctgcctggagagcacctgggggttttcccaagcaaccag
ctggccctggtccaaggcattttggagcgagtggtggacagccccgcaccccaccaaccc
atgcgcctggagaacctcagtgagaccggcagctactgggtcagggacaagcggctgccc
ccctgctcactcaaccaagccctcacctacttcctggatatcaccaccccaccaacccaa
ctgctgctccgaaagctggcccagttggccctggaagaggccgagaggcagaagctagaa
gcactgtgccagccctcggaatataataagtggaagttcaccaacagccccacgttcttg
gaggtgctcgaggaattcccatccctgcgggtgtctgccaccttcctgctctcccagctc
cctattctgaaaccgcggtactactccatcagctcctccagggaccacacacccacggag
atccacctcaccgtggccgtgctcacctaccgcacccaagatggtcaaggtcccctacac
cacggtgtctgcagcacatggcttagcagcctgaagccccaagactcagtgccctgcttt
gtacgaagtgccaacggcttccagcttcctgaggacccctcccatccttgcatcctcatc
gggcctggcacgggcatcgctcccttccgcagtttctggcagcagcggctccatgatgct
gagcacagaggggtccagggcggccgcatgatcctgttgtttgggtgccggcacccagac
gaggaccacctctatcaggaggagatgctggagatggcccggaagggggtgctgcatggg
gtgcacacagcctattctcgcctgcctggccagcccaaggtctacgttcaagacatcctg
cggcagcagctggccagtgaggtgcttcgcgtgctccacgaggagcaaggccacctctat
gtctgcggggacgtgcgcatggcccgggatgtggcccacaccctgaagaagctggtggct
gccaaactgagcctgagtgaggagcaggtcgaggactatttcttccagcttaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggtaaaaaaggatggg
gcagcagggcagcccagtaatatcagagctccaacagaccagaggagaatttaa

DBGET integrated database retrieval system