KEGG   Pteropus alecto (black flying fox): 102878515
Entry
102878515         CDS       T02993                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04714  Thermogenesis
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04922  Glucagon signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04931  Insulin resistance
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04962  Vasopressin-regulated water reabsorption
pale05016  Huntington disease
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102878515 (CREB3L4)
   04024 cAMP signaling pathway
    102878515 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    102878515 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    102878515 (CREB3L4)
   04152 AMPK signaling pathway
    102878515 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102878515 (CREB3L4)
   04922 Glucagon signaling pathway
    102878515 (CREB3L4)
   04915 Estrogen signaling pathway
    102878515 (CREB3L4)
   04926 Relaxin signaling pathway
    102878515 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    102878515 (CREB3L4)
   04918 Thyroid hormone synthesis
    102878515 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    102878515 (CREB3L4)
   04916 Melanogenesis
    102878515 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    102878515 (CREB3L4)
   04927 Cortisol synthesis and secretion
    102878515 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102878515 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102878515 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    102878515 (CREB3L4)
   04728 Dopaminergic synapse
    102878515 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    102878515 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    102878515 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102878515 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    102878515 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102878515 (CREB3L4)
   05020 Prion disease
    102878515 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    102878515 (CREB3L4)
   05031 Amphetamine addiction
    102878515 (CREB3L4)
   05034 Alcoholism
    102878515 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102878515 (CREB3L4)
   04934 Cushing syndrome
    102878515 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102878515 (CREB3L4)
   05161 Hepatitis B
    102878515 (CREB3L4)
   05163 Human cytomegalovirus infection
    102878515 (CREB3L4)
   05165 Human papillomavirus infection
    102878515 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102878515 (CREB3L4)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102878515 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB EMP24_GP25L HAUS-augmin3 OppC_N MscS_porin JMY MCU
Other DBs
NCBI-GeneID: 102878515
NCBI-ProteinID: XP_015453854
LinkDB
Position
Unknown
AA seq 395 aa
MDFGTPDLLDVWLEPPEDVFSTGSFLELGLHCPPPEAPVTRLQEQGLQGWESTGGRGRGL
QESEPEDLPKLCIDPNEVYCSEASPGSDSGLSEDPGRPDSPPAPKAPSSPALYEVIYEAG
ALERMQGEARPAVGLISIQLDQWSPPFMVPDACVVSELPLDARVHLLPPAGAVSPVPPST
LLSCQALFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSVQNQELQKKVQELERHNISLVTQLRQLQMLMTQTSNKAAQTSTCVLI
LLFSLALIILPSLSPFQGLPEARPKDYQPRGVISRNILTHKDMMENQETPVAESRLGGPP
GAKGANGSTRTLLEKMGGKTGPGGHVRTSVHADEM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatttcggaacccccgaccttctggatgtgtggctggagcccccagaggatgtcttc
tcaacaggatcctttctggagctgggactccactgtccacctccagaggccccagtgacc
aggctgcaagaacaggggctgcaaggctgggagtccacggggggccgtggccgtggcctt
caggagagtgagcctgaagatctcccgaagctttgcattgaccccaatgaagtgtactgc
tcggaagcatctcctggcagtgacagtggactctccgaggaccctggtcgcccagacagt
ccacctgcccccaaggcacccagttcccctgccctctacgaggtcatctatgaggcaggg
gccctggagaggatgcaaggggaagccaggccagccgtagggctcatctctatccagcta
gatcagtggagccccccatttatggtgcccgatgcctgcgtggtcagcgagctgcccctt
gacgcccgtgtccacctcctgcccccagctggcgctgttagcccagtgcctccttccacc
ctgctgtcctgtcaagccttgttcctgacggatgaggagaagcgtctgctggggcaggaa
ggggtctccctgccctctcacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtccggaggaaaatccggaacaagcagtcggcccaggacagtcggcggcggaagaaggag
tatatcgatggactggagagcagggtggctgcctgttctgtacagaaccaggaactacag
aagaaagtccaggagctggagaggcacaacatctccctggtgactcagctccgccagctg
cagatgcttatgactcagacttccaacaaagccgcccagaccagcacctgcgttctgatc
ctacttttctccctggctctcatcatcctgcccagtctcagcccctttcaaggtctccca
gaagccaggccaaaggattaccagcctcgcggagtgatttccaggaatatcctgactcac
aaggacatgatggagaatcaggagaccccagtggcagagtccagattgggggggccccct
ggggccaagggtgccaatggctcaacaaggacactgctggagaagatgggagggaagaca
ggccccggtgggcacgtcagaacctctgtgcacgcagatgagatgtga

KEGG   Pteropus alecto (black flying fox): 102879289
Entry
102879289         CDS       T02993                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04714  Thermogenesis
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04922  Glucagon signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04931  Insulin resistance
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04962  Vasopressin-regulated water reabsorption
pale05016  Huntington disease
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102879289 (CREB3L3)
   04024 cAMP signaling pathway
    102879289 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    102879289 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    102879289 (CREB3L3)
   04152 AMPK signaling pathway
    102879289 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102879289 (CREB3L3)
   04922 Glucagon signaling pathway
    102879289 (CREB3L3)
   04915 Estrogen signaling pathway
    102879289 (CREB3L3)
   04926 Relaxin signaling pathway
    102879289 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    102879289 (CREB3L3)
   04918 Thyroid hormone synthesis
    102879289 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    102879289 (CREB3L3)
   04916 Melanogenesis
    102879289 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    102879289 (CREB3L3)
   04927 Cortisol synthesis and secretion
    102879289 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102879289 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102879289 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    102879289 (CREB3L3)
   04728 Dopaminergic synapse
    102879289 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    102879289 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    102879289 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102879289 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    102879289 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102879289 (CREB3L3)
   05020 Prion disease
    102879289 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    102879289 (CREB3L3)
   05031 Amphetamine addiction
    102879289 (CREB3L3)
   05034 Alcoholism
    102879289 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102879289 (CREB3L3)
   04934 Cushing syndrome
    102879289 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102879289 (CREB3L3)
   05161 Hepatitis B
    102879289 (CREB3L3)
   05163 Human cytomegalovirus infection
    102879289 (CREB3L3)
   05165 Human papillomavirus infection
    102879289 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102879289 (CREB3L3)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102879289 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF1664
Other DBs
NCBI-GeneID: 102879289
NCBI-ProteinID: XP_015440644
LinkDB
Position
Unknown
AA seq 531 aa
MTRQCPGLLPDIAVFAREASYLKDAGLLRAVKRAGGPSEALSRVSLTWDRPGVVPAQPGL
KQRHRKQLEAELAGLVNGGLAAGKMASSTSPMGPIDSLELLDLLFDRQDGILRHVDLGEV
WNHVGDQVLPGPDSDDFLSCILGSGDSSPSSPLWSPAASDSGLSEDLPSDPQDTPPHTVP
VTALSSCHVTEPSKGLCPSYCPVPPGPARPPGPAAQGLEASVAIDLEMWSPGLEEQAGPA
DLPPQGGLTVKDLLLSDSGGDLQQHHLAAPHLLRPGPGHCQQLVLTEDEKKLLDKEGITL
PTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVL
HLEKQNLSLLEQLKKLQAIVVQSTSKSAQAGTCIAVLLLSFALIVLPSISPFASNKAESP
GDFTPVRVFSRTLHNDAASRVALDTNPGSEDPGLQSEAGAPQGGSPGSPKVDWDSRDMLA
LDTSTEELDNSTLVPGNLTEELSRASLLDWASPKPALNPGRIGLEAAGEEL
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgacgcggcagtgcccgggtctcctgcctgatatcgctgttttcgcgagagaggcgtcc
tacctcaaggacgctggactcctgagagccgtaaagcgggcaggggggccgagcgaagcg
ctgagtcgggtctcgctgacctgggaccgccctggcgtggtgcctgcgcagccagggctg
aagcagagacacagaaagcaactggaggcagaactggccgggctggtgaatgggggttta
gctgctggaaagatggcttcctctacctctcccatgggccccatcgacagcctggagctc
ctggatctcctgttcgaccggcaggatggaatcctgagacacgtggacctgggagaggtg
tggaaccacgtaggggaccaggtcctgccaggcccggactccgacgatttcctcagctgt
atcttgggctccggagactcatcacccagctctccactctggtctcctgcggccagtgac
agtggcctctccgaagatctgccctctgacccccaggacacccctccacacactgttcca
gtcacggctctgtccagctgccatgtcacagagcctagcaaggggctctgcccttcctac
tgtcccgtgccccccggccccgccaggccccccgggccagcagcccaggggcttgaggcc
tctgtggccatagacctagaaatgtggagcccgggcctcgaggagcaggctgggccagcg
gacctgcccccgcaaggcggcctcacagtgaaagacctcctcctctcggacagcggcggg
gacctgcaacagcatcacctggccgccccccacctgttgcgacctgggcctgggcactgc
cagcagctggtgctcacggaagacgagaagaagctgctggacaaagaaggcatcaccctg
cccactcagcttcccctcaccaagtatgaggagcgagtactgaaaaaaatccgccggaaa
atccggaacaagcagtcagcccaagaaagccggaagaagaagaaggaatatattgatggc
ctggaaactcggatgtcagcctgtacggcccagaaccaggagcttcagaggaaagtcttg
catctcgagaagcagaacctgtccctcttggagcagctgaagaaactccaggccattgtc
gtccagtccaccagcaagtcggcccaggcgggcacctgcatagcggttctgctgctttct
ttcgccctcatcgtcctcccctccatcagcccatttgcctccaacaaagccgagagcccc
ggagacttcacgcctgtgcgagttttctccagaaccctgcacaacgacgctgcttcccgc
gtggccctcgacaccaatccaggttctgaggatccaggactccagtctgaggctggtgca
ccccagggagggtctccaggaagccccaaggtggactgggactcccgggacatgctggct
ctggacacctcgacggaagagctggacaactccaccctggtcccaggcaacttgacggag
gagctgagccgggccagcctgctagactgggcatcgcctaagccagcgctcaaccctggg
cgcatagggctagaggcggcgggggaggagctgtga

KEGG   Pteropus alecto (black flying fox): 102882888
Entry
102882888         CDS       T02993                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04714  Thermogenesis
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04922  Glucagon signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04931  Insulin resistance
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04962  Vasopressin-regulated water reabsorption
pale05016  Huntington disease
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102882888 (CREB3L2)
   04024 cAMP signaling pathway
    102882888 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    102882888 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    102882888 (CREB3L2)
   04152 AMPK signaling pathway
    102882888 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102882888 (CREB3L2)
   04922 Glucagon signaling pathway
    102882888 (CREB3L2)
   04915 Estrogen signaling pathway
    102882888 (CREB3L2)
   04926 Relaxin signaling pathway
    102882888 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    102882888 (CREB3L2)
   04918 Thyroid hormone synthesis
    102882888 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    102882888 (CREB3L2)
   04916 Melanogenesis
    102882888 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    102882888 (CREB3L2)
   04927 Cortisol synthesis and secretion
    102882888 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102882888 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102882888 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    102882888 (CREB3L2)
   04728 Dopaminergic synapse
    102882888 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    102882888 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102882888 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102882888 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    102882888 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102882888 (CREB3L2)
   05020 Prion disease
    102882888 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    102882888 (CREB3L2)
   05031 Amphetamine addiction
    102882888 (CREB3L2)
   05034 Alcoholism
    102882888 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102882888 (CREB3L2)
   04934 Cushing syndrome
    102882888 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102882888 (CREB3L2)
   05161 Hepatitis B
    102882888 (CREB3L2)
   05163 Human cytomegalovirus infection
    102882888 (CREB3L2)
   05165 Human papillomavirus infection
    102882888 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102882888 (CREB3L2)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102882888 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 102882888
NCBI-ProteinID: XP_006910551
UniProt: L5KPW7
LinkDB
Position
Unknown
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGESEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRVQSPFTHVTSSDSFNDDDVESEKWYLCTDF
PSATIKTEPITDEPPPGLVPSVTLTITAISTPLEKVEPPLEMSTGVDSSCQTIIPQIKLE
PHEVDQFLNFSPKEASVDHLHLPPTPPSSHSSDSEGSLSPSPRLHPFGPAQTHSPARAVV
RAPSTLSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSMPEPYT
ASIVRSRNLLIYEEHSPLEEPSSPASAGELGRWDRGSALLRASGLEPRPDMDLPHFILAN
ETSLEKSVLLELQQHLVGTKLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggagaaagcgaggctctcatgtatcacacgcacttctcggaacttctg
gatgagttttcccagaatgtcttgggtcagctcttgaacgatcccttcctctcagagaag
agcgtgtcgatggaggtggagccatcgccaacatccccagcgcctctcatccaggcggaa
cacagctactccctgtgcgaggagcctcgggtccagtcaccattcacccacgttaccagc
agtgacagcttcaatgatgatgatgtggaaagtgagaaatggtacctgtgtacagacttt
ccttcagcaaccatcaagactgagccgatcacggatgagccacccccgggacttgttccc
tctgttactttgaccatcacagccatctccacccctttagagaaggtggaacctcctctg
gaaatgagtactggggtcgattcttcgtgccagaccattattcctcagatcaagctggag
cctcacgaagtggatcagttcctcaacttctctcccaaggaagcctccgtggaccacctg
cacctaccgcccacccctcccagcagccacagcagtgactcggagggcagcctgagcccc
agcccgcgcctgcaccccttcggcccggcccagacgcacagtccagcccgagccgtggtg
cgggccccctccacactttccagttctcccctgctcacagcacctcacaaactgcagggg
tcaggccccctggtcctgacagaggaggagaagcggaccctgatcgccgagggctacccc
atccccaccaagctgcctctgaccaaatcggaggagaaggccctgaagaaaatccggagg
aaaatcaagaataagatttctgcccaggaaagtaggagaaagaagaaagaatacatggac
agcttagagaaaaaggtggagtcttgttcaaccgagaacttggagcttcggaagaaggtt
gaggttctggagaataccaacagaactctcctccagcaactgcagaagcttcagactttg
gtgatgggcaaggtttctcgcacctgcaagttggccggcacgcagaccggcacctgcctc
atggtcgtggtgttatgctttgccgtggcctttggcagcttctttcagggctatgggccc
tatccttctgccaccaagatggctctgcccagccagcattccatgccagagccgtacaca
gcctccatcgtgaggtccaggaacctgctcatctatgaggagcactctccgctggaggag
ccgtccagcccggcctcggccggggagctcgggcgctgggacagaggctccgccctgctc
agggcgtcggggctggagcccaggccagacatggatctcccccatttcattctcgcgaat
gagaccagcctggagaagtcagtgctgttggagctgcagcagcacttggtcggcaccaaa
ctggaggggaacgaaacactaaaagtcgtagagctcgacagaagagtgaacgccaccttc
taa

KEGG   Pteropus alecto (black flying fox): 102884583
Entry
102884583         CDS       T02993                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04714  Thermogenesis
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04918  Thyroid hormone synthesis
pale04922  Glucagon signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04931  Insulin resistance
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04962  Vasopressin-regulated water reabsorption
pale05016  Huntington disease
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102884583 (CREB5)
   04024 cAMP signaling pathway
    102884583 (CREB5)
   04022 cGMP-PKG signaling pathway
    102884583 (CREB5)
   04151 PI3K-Akt signaling pathway
    102884583 (CREB5)
   04152 AMPK signaling pathway
    102884583 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102884583 (CREB5)
   04922 Glucagon signaling pathway
    102884583 (CREB5)
   04915 Estrogen signaling pathway
    102884583 (CREB5)
   04926 Relaxin signaling pathway
    102884583 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    102884583 (CREB5)
   04918 Thyroid hormone synthesis
    102884583 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    102884583 (CREB5)
   04925 Aldosterone synthesis and secretion
    102884583 (CREB5)
   04927 Cortisol synthesis and secretion
    102884583 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102884583 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102884583 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    102884583 (CREB5)
   04728 Dopaminergic synapse
    102884583 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    102884583 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    102884583 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102884583 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    102884583 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102884583 (CREB5)
   05020 Prion disease
    102884583 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    102884583 (CREB5)
   05031 Amphetamine addiction
    102884583 (CREB5)
   05034 Alcoholism
    102884583 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102884583 (CREB5)
   04934 Cushing syndrome
    102884583 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102884583 (CREB5)
   05161 Hepatitis B
    102884583 (CREB5)
   05163 Human cytomegalovirus infection
    102884583 (CREB5)
   05165 Human papillomavirus infection
    102884583 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102884583 (CREB5)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    102884583 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 DivIC
Other DBs
NCBI-GeneID: 102884583
NCBI-ProteinID: XP_015445000
LinkDB
Position
Unknown
AA seq 502 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNLLSDQTPTPTRFLK
NCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNTVGGAMAGPGAHQLGSTRMPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
ANGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQAQQVSPATQQMQPTQTIQPPQPTGGRR
RRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKN
EVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPAASPVPACSQQQVIQHNTITTSSAVS
EVVGSSTLSQLTTHRTDLNPIL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaatttggagcaggagaggccatttgtctgcagtgccccgggctgctcccagcgcttc
ccaacagaggaccatctgatgattcataggcacaagcatgagatgactttgaagtttccc
tcaataaaaacagacaatctgttatcagatcagactccgaccccaacaaggttcctgaag
aactgcgaggaagtggggctcttcagcgagctggactgctccctcgagcatgagttccgg
aaggcccaggaggaggagagcagcaagcggaatatctcgatgcataacacagttggtggg
gccatggcggggcccggagctcaccagctcggcagcacccggatgcccaaccatgacacc
agcgttgtgattcagcaagccatgccgtcaccccagtccagctctgtcatcacgcaggcg
ccttccaccaaccgccagatcgggcctgtcccaggctctctatcttctctgctacatctc
cacaacagacagagacagcccatgccagcctccatgcccgggaccctgcccaaccctaca
atgccaggatcttccgccgtcttgatgccaatggagagacaaatgtcagtgaactccaac
ctcctgggaatgcaaggtccaaatctcagcaacccctgtgcttctccccaagtccagcca
atgcattcagaagccaaaatgaggttgaaggccgcactgactcaccatcctgctgccatg
gcaaatgggaatatgaacaccatgggacacatgatggaaatgatgggctcccggcaggac
cagacgccgcaccatcacatgcactcccacccgcatcagcaccagacactgccggcccat
cacccctacccgcaccagcaccagcacccagcacaccatcctcatcctcaaccccatcac
cagcagaaccacccacaccatcactcccactcccacctccatgcacacccggcacatcac
cagacctcgccacacccacccctgcactccggcaaccaagcacagcaggtttcaccagcg
acgcaacagatgcagccaacccagacgatacagccgccccagcccacaggggggcgccgg
cgaagggtggtggacgaggatcctgatgagaggaggcggaaatttctggaacgaaaccga
gcagccgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaa
gctgaagaactcacccagacaaacatgcaacttcagaatgaagtgtctatgttgaagaac
gaggtggcacagctgaaacagttgttgttaacacataaagactgcccaataacagccatg
cagaaagaatcgcaaggatatctaagtccagagagtagcccagcggcgagcccggtcccc
gcttgctctcagcagcaggtcatccagcataacaccatcaccacttcctcggcagtcagt
gaggtcgtaggaagctccaccctcagccagctcaccactcacagaacagacctgaatcca
attctttaa

KEGG   Pteropus alecto (black flying fox): 102886510
Entry
102886510         CDS       T02993                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04714  Thermogenesis
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04922  Glucagon signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04931  Insulin resistance
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04962  Vasopressin-regulated water reabsorption
pale05016  Huntington disease
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102886510 (CREB3)
   04024 cAMP signaling pathway
    102886510 (CREB3)
   04022 cGMP-PKG signaling pathway
    102886510 (CREB3)
   04151 PI3K-Akt signaling pathway
    102886510 (CREB3)
   04152 AMPK signaling pathway
    102886510 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102886510 (CREB3)
   04922 Glucagon signaling pathway
    102886510 (CREB3)
   04915 Estrogen signaling pathway
    102886510 (CREB3)
   04926 Relaxin signaling pathway
    102886510 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    102886510 (CREB3)
   04918 Thyroid hormone synthesis
    102886510 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    102886510 (CREB3)
   04916 Melanogenesis
    102886510 (CREB3)
   04925 Aldosterone synthesis and secretion
    102886510 (CREB3)
   04927 Cortisol synthesis and secretion
    102886510 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102886510 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102886510 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    102886510 (CREB3)
   04728 Dopaminergic synapse
    102886510 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    102886510 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    102886510 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102886510 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    102886510 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102886510 (CREB3)
   05020 Prion disease
    102886510 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    102886510 (CREB3)
   05031 Amphetamine addiction
    102886510 (CREB3)
   05034 Alcoholism
    102886510 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102886510 (CREB3)
   04934 Cushing syndrome
    102886510 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102886510 (CREB3)
   05161 Hepatitis B
    102886510 (CREB3)
   05163 Human cytomegalovirus infection
    102886510 (CREB3)
   05165 Human papillomavirus infection
    102886510 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102886510 (CREB3)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102886510 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Fer4_14 ADIP
Other DBs
NCBI-GeneID: 102886510
NCBI-ProteinID: XP_006916069
LinkDB
Position
Unknown
AA seq 393 aa
MLGSPLKTIRPPRRKQGCGAIRRKRTNCVYGMELALDPDDQDLLGFLLEESGELGAVPKE
AMEAPMSWELPLSQALSDWDIEDFLSSLQSPPASLSVLSNSNPCLVHHDHTYSLPQEHVS
IDLDSESYGKEGALIPLHVEEPSEQEMVRLILTDEEKRLLEQEGITLPGTFPLTKMEEQV
LKRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYTAQNLELQNKVQLLEEQNLSLLDQL
RRLQAMVVQIANKTSSSSTCVLVLLFSFCLLLVPAMYSSDTRGRLPAEHGVLSRQLRGLS
EDPHQLELPALQPEVPKDSSDRELQAPGNSCLFYHMPQALGTEPPMKLPLPDPFSKSPRP
DPILSLHANLTREGEWVPAHSSICVILQGRHLG
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctcgggagcccgctgaagaccatccgccctccccggcggaagcaagggtgcggcgca
atccggaggaaacggacgaactgcgtgtacggtatggagttggcgttggacccggatgac
caggacctgctgggcttcctgctggaggaaagcggagagttaggggcggtgcccaaagag
gccatggaggctccaatgagctgggagttaccgctttcccaggcactgagcgattgggac
atagaggatttcctgagctctctgcagagtcccccagcatcgttgagcgttctcagcaac
tcgaacccctgtcttgtccaccatgatcacacctattctctcccacaggaacatgtttcc
atagatctagatagtgagagctatggaaaagagggggccctgattcccttgcatgtggag
gagccgtcagagcaggagatggttaggctgatactgacagatgaggagaagaggctattg
gagcaggaggggattactctgcctgggacttttcctctcactaagatggaggaacaagtt
ctaaaacgagtgcggaggaagattcgaaataaaaagtctgcccaagagagccgcaggaag
aagaaggtgtatgtgggaagtttagaaagcagggtcttaaaatacacagcccagaatctg
gagctacagaacaaagtacagctcctggaggaacagaatctgtctctcctggatcagttg
aggaggctccaggccatggtggttcagatagcaaacaaaaccagcagcagcagcacctgt
gtcttggtcctgctgttctccttctgtctcctccttgtacccgctatgtactcctctgac
acaagggggcgcctgccagctgagcatggagtgttatcccgccagcttcgtggcctcagt
gaagaccctcaccagctggaactgcctgccttgcagccagaggtaccaaaggacagctca
gaccgagagctccaggctcctggcaattcttgcctgttctaccacatgcctcaggctctt
ggtacagagcctcccatgaagttgccactccctgaccccttctcaaagtccccccgccca
gatcccatcctttccctgcatgcaaatctcacaagagagggagaatgggtacctgctcac
agctccatatgtgttatcttacaaggcagacacttaggctag

KEGG   Pteropus alecto (black flying fox): 102888198
Entry
102888198         CDS       T02993                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04380  Osteoclast differentiation
pale04612  Antigen processing and presentation
pale04668  TNF signaling pathway
pale04710  Circadian rhythm
pale04713  Circadian entrainment
pale04714  Thermogenesis
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04922  Glucagon signaling pathway
pale04924  Renin secretion
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04931  Insulin resistance
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04962  Vasopressin-regulated water reabsorption
pale05016  Huntington disease
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102888198 (CREB1)
   04024 cAMP signaling pathway
    102888198 (CREB1)
   04022 cGMP-PKG signaling pathway
    102888198 (CREB1)
   04151 PI3K-Akt signaling pathway
    102888198 (CREB1)
   04152 AMPK signaling pathway
    102888198 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102888198 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    102888198 (CREB1)
   04922 Glucagon signaling pathway
    102888198 (CREB1)
   04915 Estrogen signaling pathway
    102888198 (CREB1)
   04926 Relaxin signaling pathway
    102888198 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    102888198 (CREB1)
   04918 Thyroid hormone synthesis
    102888198 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    102888198 (CREB1)
   04916 Melanogenesis
    102888198 (CREB1)
   04924 Renin secretion
    102888198 (CREB1)
   04925 Aldosterone synthesis and secretion
    102888198 (CREB1)
   04927 Cortisol synthesis and secretion
    102888198 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102888198 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102888198 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    102888198 (CREB1)
   04728 Dopaminergic synapse
    102888198 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102888198 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    102888198 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102888198 (CREB1)
   04713 Circadian entrainment
    102888198 (CREB1)
   04714 Thermogenesis
    102888198 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102888198 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102888198 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102888198 (CREB1)
   05020 Prion disease
    102888198 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    102888198 (CREB1)
   05031 Amphetamine addiction
    102888198 (CREB1)
   05034 Alcoholism
    102888198 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102888198 (CREB1)
   04934 Cushing syndrome
    102888198 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102888198 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102888198 (CREB1)
   05161 Hepatitis B
    102888198 (CREB1)
   05163 Human cytomegalovirus infection
    102888198 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102888198 (CREB1)
   05165 Human papillomavirus infection
    102888198 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102888198 (CREB1)
   03029 Mitochondrial biogenesis [BR:pale03029]
    102888198 (CREB1)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102888198 (CREB1)
Mitochondrial biogenesis [BR:pale03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    102888198 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf HNF-1A_C
Other DBs
NCBI-GeneID: 102888198
NCBI-ProteinID: XP_006921453
UniProt: L5K0P3
LinkDB
Position
Unknown
AA seq 341 aa
MTMESGAENQQSGDAAVTEPENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaacct
gaaaaccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tctcaaaaacgaagagaaattctttcgaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtaccaaggattgaagaagagaagtctgaagaagagact
tcagcccctgccatcaccactgtaacggtgccaactccgatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacaaacataccagatccgcacagcacccactagc
accattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcccgaaagagagaggttcgcctaatgaagaacagggaagcagcacgagagtgc
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgctggaaaac
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Pteropus alecto (black flying fox): 102889014
Entry
102889014         CDS       T02993                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04714  Thermogenesis
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04918  Thyroid hormone synthesis
pale04922  Glucagon signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102889014 (ATF2)
   04668 TNF signaling pathway
    102889014 (ATF2)
   04022 cGMP-PKG signaling pathway
    102889014 (ATF2)
   04151 PI3K-Akt signaling pathway
    102889014 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102889014 (ATF2)
   04922 Glucagon signaling pathway
    102889014 (ATF2)
   04915 Estrogen signaling pathway
    102889014 (ATF2)
   04926 Relaxin signaling pathway
    102889014 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    102889014 (ATF2)
   04918 Thyroid hormone synthesis
    102889014 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    102889014 (ATF2)
   04925 Aldosterone synthesis and secretion
    102889014 (ATF2)
   04927 Cortisol synthesis and secretion
    102889014 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102889014 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    102889014 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    102889014 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102889014 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102889014 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    102889014 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    102889014 (ATF2)
   05031 Amphetamine addiction
    102889014 (ATF2)
   05034 Alcoholism
    102889014 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102889014 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102889014 (ATF2)
   05161 Hepatitis B
    102889014 (ATF2)
   05163 Human cytomegalovirus infection
    102889014 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102889014 (ATF2)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    102889014 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2
Other DBs
NCBI-GeneID: 102889014
NCBI-ProteinID: XP_006921284
LinkDB
Position
Unknown
AA seq 505 aa
MKFKLRVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIVR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacgtgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgttcaatgagttggcaagtccatttgagaatgaattcaagaaagcttca
gaagacgacattaaaaaaatgcctctagatttatctcctcttgcaacacccatcgtaaga
agcaaaattgaggagccatccgttgtagaaacaactcaccaggatagtcctttacctcat
ccagaatctactaccagtgatgaaaaggaagtaccattggcacaaactgcacagcctaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtgattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctccaacaggccaattgttcctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgtg
catgttccagctgcagtcccactcgttcgaccagtcaccatggtgcctagtgttccagga
attccgggtccttcctctcctcaaccagtacagtcggaagcaaaaatgagattaaaagct
gctttgactcagcaacatcctcctgttaccaatggtgatactgtcaaaggtcatggtagc
ggattggttaggactcagtcagaggaatctcgaccacagtcattacaacagccagctaca
tccactacagaaactccggcttctccagctcacacgactccacagacccaaaatacaagt
gggcgtcgaagaagagcagctaatgaagatcctgatgaaaaaaggaggaagtttctagag
agaaatagagcagcagcctcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatgggcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcacactgctgataaagatgatagttcagaagat
ctgtcagtgccgagtagtccacatactgaagctatacagcatagttctgtcagcacatcc
aatggagtcagttcaacctccaaggcagaagctgtagccacttcagtcctcacccagatg
gcagaccagagtacagagcctgcactttcacagattgttatggctccttcctcgcaatca
cagccctcaggaagttga

KEGG   Pteropus alecto (black flying fox): 102894633
Entry
102894633         CDS       T02993                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04714  Thermogenesis
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04918  Thyroid hormone synthesis
pale04922  Glucagon signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04931  Insulin resistance
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale04962  Vasopressin-regulated water reabsorption
pale05016  Huntington disease
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102894633 (CREB3L1)
   04024 cAMP signaling pathway
    102894633 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    102894633 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    102894633 (CREB3L1)
   04152 AMPK signaling pathway
    102894633 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102894633 (CREB3L1)
   04922 Glucagon signaling pathway
    102894633 (CREB3L1)
   04915 Estrogen signaling pathway
    102894633 (CREB3L1)
   04926 Relaxin signaling pathway
    102894633 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    102894633 (CREB3L1)
   04918 Thyroid hormone synthesis
    102894633 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    102894633 (CREB3L1)
   04916 Melanogenesis
    102894633 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    102894633 (CREB3L1)
   04927 Cortisol synthesis and secretion
    102894633 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102894633 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102894633 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    102894633 (CREB3L1)
   04728 Dopaminergic synapse
    102894633 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    102894633 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102894633 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102894633 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102894633 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102894633 (CREB3L1)
   05020 Prion disease
    102894633 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    102894633 (CREB3L1)
   05031 Amphetamine addiction
    102894633 (CREB3L1)
   05034 Alcoholism
    102894633 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102894633 (CREB3L1)
   04934 Cushing syndrome
    102894633 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102894633 (CREB3L1)
   05161 Hepatitis B
    102894633 (CREB3L1)
   05163 Human cytomegalovirus infection
    102894633 (CREB3L1)
   05165 Human papillomavirus infection
    102894633 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102894633 (CREB3L1)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102894633 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 102894633
NCBI-ProteinID: XP_006908134
UniProt: L5KX81
LinkDB
Position
Unknown
AA seq 519 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDMEHGAWVLG
HKLCSVMVKQEQSPDLPVDPLAASSAMAAAAAMATTPLLGLSPLSRLPVPHQAPGEMTQL
PMIKAEPQEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMATDSIYTASQM
PSRSLLFYDEGPGSWEDGRSTLMPVEPPDGWEIKPGGSVEQRPQDHLQHDHLDSTHETTK
YLSEAWPKDVGNGTSPNFSHPKEWFHERDLGPNTTIKLS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacgccgtcttagaacccttcccggccgacaggctgttccccggatccagcttcctg
gacctgggggatctgaacgagtcggatttcctcaacaatgcgcacttccctgagcacctg
gaccacttcgcggagaacatggaagacttctccaacgacctgttcagcagtttctttgat
gaccctgtgctggacgagaagagccctctactggacatggaactggactccccaacgcca
ggcatccaggctgagcacagctactccctgagcggtgactcggcgcctcagagtcccctt
gtgcccatcaagatggaggacaccacccaagacatggaacatggagcctgggtgctggga
cacaaactgtgctccgtcatggtgaagcaagagcagagcccagatctgcctgtggaccct
ctggccgcctcctcagccatggctgccgctgccgccatggccaccaccccactgctgggc
ctcagccccctgtccaggctgcccgtcccccaccaggccccaggagagatgactcagctg
ccaatgatcaaagcagagccccaggaggtgaatcagttcctcaaagtgacaccagaggac
ctggtgcagatgcctccgacgccccccagcagccatggcagtgacagtgatggctcccag
agtccccgatctctgcccccctccagccctgtccggcccatggcccgttcctccactgcc
atctccacctcccccctcctcaccgcccctcacaaattacaagggacatcagggccactg
cttctgacagaggaggagaagcgcaccctgattgctgagggctaccccatccccacaaaa
ctccccctcaccaaagctgaggagaaagccttgaagagggtccggagaaaaatcaagaac
aagatctcagcccaggagagccgccgtaagaagaaggaatacgtggagtgtctagaaaag
aaagtggagacatttacatcggagaacaacgaactgtggaagaaggtggagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggctgccacccagactgggacctgcctaatggtggcagcc
ttgtgtttcgttctggtgctgggctccctcgtgccctgcctccctgagttctcctccggc
tcccagactgtgaaggaagaccccatggccactgacagcatctacacagccagtcagatg
ccttcccgaagcctcctgttctacgatgaggggccagggtcctgggaggatggccgcagc
accctaatgcctgtggagcccccagatggctgggaaatcaagcccggggggtcagtggag
cagcgaccccaggaccacctgcaacatgaccacctggacagcacccacgagaccaccaag
tacctgagtgaagcctggccaaaagatgtcggaaatggcaccagccccaacttctcccac
cccaaggagtggttccatgagagggatctgggcccaaacaccaccatcaagctctcgtag

KEGG   Pteropus alecto (black flying fox): 102896553
Entry
102896553         CDS       T02993                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04137  Mitophagy - animal
pale04141  Protein processing in endoplasmic reticulum
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04720  Long-term potentiation
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04918  Thyroid hormone synthesis
pale04922  Glucagon signaling pathway
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04932  Non-alcoholic fatty liver disease
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102896553 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102896553 (ATF4)
   04668 TNF signaling pathway
    102896553 (ATF4)
   04022 cGMP-PKG signaling pathway
    102896553 (ATF4)
   04151 PI3K-Akt signaling pathway
    102896553 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102896553 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    102896553 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102896553 (ATF4)
   04922 Glucagon signaling pathway
    102896553 (ATF4)
   04912 GnRH signaling pathway
    102896553 (ATF4)
   04915 Estrogen signaling pathway
    102896553 (ATF4)
   04926 Relaxin signaling pathway
    102896553 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    102896553 (ATF4)
   04918 Thyroid hormone synthesis
    102896553 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    102896553 (ATF4)
   04925 Aldosterone synthesis and secretion
    102896553 (ATF4)
   04927 Cortisol synthesis and secretion
    102896553 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102896553 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    102896553 (ATF4)
   04728 Dopaminergic synapse
    102896553 (ATF4)
   04720 Long-term potentiation
    102896553 (ATF4)
   04722 Neurotrophin signaling pathway
    102896553 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    102896553 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102896553 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    102896553 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102896553 (ATF4)
   05012 Parkinson disease
    102896553 (ATF4)
   05014 Amyotrophic lateral sclerosis
    102896553 (ATF4)
   05020 Prion disease
    102896553 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    102896553 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    102896553 (ATF4)
   05031 Amphetamine addiction
    102896553 (ATF4)
   05034 Alcoholism
    102896553 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102896553 (ATF4)
   04934 Cushing syndrome
    102896553 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102896553 (ATF4)
   05161 Hepatitis B
    102896553 (ATF4)
   05163 Human cytomegalovirus infection
    102896553 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102896553 (ATF4)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    102896553 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 Fez1 DUF3450 Nop53 Laminin_II AAA_13 bZIP_Maf Baculo_F ZapB
Other DBs
NCBI-GeneID: 102896553
NCBI-ProteinID: XP_006917462
UniProt: L5KB57
LinkDB
Position
Unknown
AA seq 351 aa
MTEMSFLNSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSGDKAKAGSSE
WLAVEGLVSASDSGKEDAFTGTDWMVEKMDLKEFDFDSLLSLDDLETMPDELLATLDETC
DLFDPVVQETNKEPPQTANQIGHLSENLPKTDQVAPFTFLQSLPLCPGVLSSTPDHSFSL
ELGSEVDISEGDRKSDSTAYVTVVPQCIKEEDATSDNDSGICMSPESYPGSPQQSPSISR
ASPNRSLLSPATLCGSARPKPYDPPGEKMVAKGKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKAKGRKRAP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgaacagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagacgactacctggaggtg
gccaagcacttcaaacctcatggattctccggcgacaaggctaaggctggctcctccgaa
tggctggctgtggaggggttggtcagtgcctcagacagcggcaaggaggatgccttcacc
gggacagattggatggtggagaaaatggatctcaaggagtttgattttgattctctgtta
agtttagacgatctggaaaccatgcccgatgagcttttggccacgttggatgagacttgt
gatctctttgaccccgtagtccaggagactaataaggagcccccccagacagcaaaccaa
attggccatctctcagaaaatttaccaaaaaccgaccaggttgcccccttcaccttcctg
caatctcttcccctttgtccaggggtcttgtcttccactccagatcattcctttagttta
gagttaggcagtgaagttgacatctctgaaggagataggaagtcagactccactgcttac
gttactgtggtccctcagtgcataaaggaggaggatgccacttcagataacgacagtggt
atctgtatgagccctgagtcctatccgggctctccccagcaaagcccctctatctccagg
gcctctccaaataggagccttctgtctccagctaccctctgtggctctgcccgccccaaa
ccctatgaccctcctggagagaagatggtagctaaaggaaagggcgagaaattggataag
aagctgaaaaaaatggagcagaacaagacagcagccactagataccgccagaagaagagg
gcagagcaggaggctctcactggtgagtgtaaggagctagaaaagaagaacgaggctctg
aaagagaaggcagattccttggccaaggagatccagtatctgaaagatttgatagaagag
gtccgtaaggcaaaggggaggaaaagggccccctag

KEGG   Pteropus alecto (black flying fox): 102898128
Entry
102898128         CDS       T02993                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X3
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04141  Protein processing in endoplasmic reticulum
pale04151  PI3K-Akt signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04918  Thyroid hormone synthesis
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102898128 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102898128 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102898128 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102898128 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102898128 (ATF6B)
   04915 Estrogen signaling pathway
    102898128 (ATF6B)
   04926 Relaxin signaling pathway
    102898128 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102898128 (ATF6B)
   04918 Thyroid hormone synthesis
    102898128 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102898128 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102898128 (ATF6B)
   04927 Cortisol synthesis and secretion
    102898128 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102898128 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102898128 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102898128 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102898128 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102898128 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102898128 (ATF6B)
   05031 Amphetamine addiction
    102898128 (ATF6B)
   05034 Alcoholism
    102898128 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102898128 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102898128 (ATF6B)
   05161 Hepatitis B
    102898128 (ATF6B)
   05163 Human cytomegalovirus infection
    102898128 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102898128 (ATF6B)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102898128 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB bZIP_Maf GIT_CC DUF4407 YabA Docking
Other DBs
NCBI-GeneID: 102898128
NCBI-ProteinID: XP_006904685
UniProt: L5L5A9
LinkDB
Position
Unknown
AA seq 717 aa
MGRGGPWEPSHGCGGRGVKMAELMLLSEIADPTRFFTDNLLNPEDWDCTLYTGLDEVAEE
QTQLFRCPEQDVPFGSSMLDVGMDVSLPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSES
SHLSTEPSSQASGVGEVLVVKIESLAPPLCLLRDDSTPPFETIHINVGPTSDNPSDVHTK
IEPVSPSSSVNSEASLLSAESPNQDFIGEILEVKTESPSPQECLLQDVPGPPPGAFQISM
SPSPDGSSGKALPTRKPPLQPKPVVITTVPVPPRAMPPSTTVLLQPLVQPPPVSPVVLIQ
GAIRVQPEGPPPPAPRPERKSIVPAPMPGNSCPPEVDTKLLKRQQRMIKNRESACQSRRK
KKEYLQGLEARLQAVLADNQQLRRENAALRRRLEVLLAENSELKLGSGNRKVVCIMVFLL
FVAFNFGPVSISEPPLAPVSPGMSREAPRPRRHLLEFSAQLPVHGVETLKGSQGPEESQP
SPEGWPGFRNLTAFTRGAKELLLRDLDQLFLSSDCRHVNRTESLRLADELSGWVQRHQRG
RRKLPQRAQERQKSQLQKTSPPVKAVPTQPPGPLERDSVGQLQLYRHPDRSQPEFLDAID
RREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGAPGDYEEMMQIE
CEVMDTRVIHIKTSTVPPSLRKQPSSTPGNTTGGPLPASAAGQAPQATHRPLYLNHP
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggggagaggcgggccttgggaaccgtctcatggttgtggggggcggggggtaaaaatg
gcggagctcatgctcctcagcgagattgcggacccgacgcgtttttttacagacaacttg
ctgaacccggaggactgggactgcaccttgtataccggcctggatgaagtggctgaggag
cagacgcagctctttcgttgtccggagcaggatgtcccgtttggcagcagcatgctggat
gtgggaatggatgtcagcctccctgaacccccatgggaccccctgcctatcttcccagat
cttcaggtgaagtcggagccatcctctccctgctcttcctcttctctcagctcggaatca
tcacatctttccacagagccctccagccaggcctctggtgtgggggaggtgctggttgtg
aagatagagtccttggcacctccactctgcctcctgagagatgattcaacacccccattt
gaaaccatccatatcaatgtgggccccacctctgataatccctcagatgtccataccaag
atagaacctgtttctccatcttcctccgtcaactctgaggcttccctgctctcagcagag
tctcccaaccaggattttataggagagatactagaagtgaagacagagtctccatcccct
caagagtgtctcctgcaggatgtcccaggccccccacctggagctttccagattagcatg
agtccatcccccgatggatcctcaggcaaagccctgcccacccggaagccaccactgcag
cccaaacctgtggtgataaccactgtcccagtgccacccagagctatgcctcccagcacc
accgtccttttgcagccccttgtccagccacccccagtgtccccagttgtcctcatccaa
ggtgctattcgagtccagcctgaagggccgcccccgcctgctccacggcctgaaaggaag
agcattgttccagctcctatgcctgggaactcctgccctcctgaagtggatacaaagctg
ctgaagcggcagcagcgaatgatcaagaaccgggagtccgcttgccagtcccggaggaag
aagaaagagtacctgcagggtctggaagctcggctgcaggcggtgctggctgacaaccag
cagctgcgccgggagaatgctgccctccggcggcgactggaggtgctgctggctgagaac
agcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtcttcctgctc
ttcgttgccttcaacttcgggcctgtcagcatcagtgagccaccattggctcctgtctct
cctgggatgagcagagaggcgcctcgaccccggagacacttgctagaattctcagcgcaa
ttgccggttcatggggttgaaacccttaagggttcccagggccctgaggagtcccagccc
agccctgaaggctggccaggtttcaggaacctgacagccttcaccaggggtgccaaggaa
ctgctgctaagagacctggaccagctcttcctctcctctgactgccggcacgtcaaccga
actgagtccctgaggcttgctgacgagctgagtggctgggtgcagcgccaccagagaggc
cggcggaagctccctcagagggcccaggagagacagaagtctcagctacagaagacatcg
cctccagttaaggcagtccccacccaaccccccgggcccttagaaagggattctgtaggc
caactgcagctgtatcgccacccagaccgttcacagccagaattcctggatgcgattgac
cgacgagaagacacattttatgttgtctccttccgacgagaccacttgctgctcccagcc
atcagccacaacaagacctctcggcctaagatgtccctggtgatgcccgccatggccccc
aatgagacggtgtcaggccggggggcccctggggactatgaggagatgatgcagatcgag
tgtgaggtcatggacaccagggtgattcacatcaagacctccacagtgcccccttcactc
cgaaaacagccgtcctcaaccccaggcaataccacaggtggccccctgccagcttccgca
gctggccaggccccccaggccacccatcggcccctctacctcaatcatccctga

DBGET integrated database retrieval system