KEGG   Pteropus alecto (black flying fox): 102878565
Entry
102878565         CDS       T02993                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04115  p53 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04370  VEGF signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05134  Legionellosis
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05215  Prostate cancer
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102878565 (CASP9)
   04151 PI3K-Akt signaling pathway
    102878565 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102878565 (CASP9)
   04215 Apoptosis - multiple species
    102878565 (CASP9)
   04115 p53 signaling pathway
    102878565 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102878565 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878565 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102878565 (CASP9)
   05212 Pancreatic cancer
    102878565 (CASP9)
   05215 Prostate cancer
    102878565 (CASP9)
   05213 Endometrial cancer
    102878565 (CASP9)
   05222 Small cell lung cancer
    102878565 (CASP9)
   05223 Non-small cell lung cancer
    102878565 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102878565 (CASP9)
   05012 Parkinson disease
    102878565 (CASP9)
   05014 Amyotrophic lateral sclerosis
    102878565 (CASP9)
   05016 Huntington disease
    102878565 (CASP9)
   05020 Prion disease
    102878565 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    102878565 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102878565 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102878565 (CASP9)
   05152 Tuberculosis
    102878565 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102878565 (CASP9)
   05161 Hepatitis B
    102878565 (CASP9)
   05160 Hepatitis C
    102878565 (CASP9)
   05164 Influenza A
    102878565 (CASP9)
   05162 Measles
    102878565 (CASP9)
   05168 Herpes simplex virus 1 infection
    102878565 (CASP9)
   05163 Human cytomegalovirus infection
    102878565 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102878565 (CASP9)
   05169 Epstein-Barr virus infection
    102878565 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102878565 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102878565 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102878565 (CASP9)
   01002 Peptidases and inhibitors [BR:pale01002]
    102878565 (CASP9)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     102878565 (CASP9)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102878565 (CASP9)
Peptidases and inhibitors [BR:pale01002]
 Cysteine peptidases
  Family C14: caspase family
   102878565 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 102878565
NCBI-ProteinID: XP_006914396
LinkDB
Position
Unknown
AA seq 435 aa
MDEADRQLLRRCRVRLVGELQVASLWDALLNYELFTPDMIEDIQRAGSGSRRDQARQLIT
DLETRGSQALPLFISCLEDTGQNSLASLLRTNSQAAKRNPEAIKPLDLMPVVVRPVSGKP
EELSMVKQDPSKLTPRPEGLRPEAPRPVDISSRRFSDVRAQEGLRGNADLVYVLNADPCG
HCLIINNVHFCLKSGLSTRPGSDVDCEKLQRRFRLLHFMVEVKCDLTGKQIVQALVELAQ
RDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGFLVSIEKIVNIFNGTGCPSLGGKPKL
FFIQACGGERKDCGFAVVSTSPEDRAPGSNPEPDAVPFQDRSGSCDQPDAVSNLPTPSDI
FVSYSTFPGFVSWRDPKSGSWYIETLDNIFEQWAHSEDLHSLLLRVANAVSQKGIYKQIP
GCFNFLRKKLFFKTS
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggacgaggctgaccggcaacttctgcggcgatgccgggtgcggctggtcggcgagttg
caggtggcatctctctgggacgctctactgaactacgagctcttcacgcccgacatgatc
gaagacatccagcgagcgggctctgggtctcgtcgcgatcaggccaggcagctgatcaca
gatctggagactcgagggagtcaggcccttcctttgttcatctcctgcttggaggacacg
ggccagaacagcctggcttcattgctgagaacgaacagccaagcagcaaagcggaatccg
gaggccatcaaacccctggacctcatgcctgtggtggttagaccagtgagcggcaaacca
gaggagctgagcatggtaaagcaagatccgtctaaactgaccccaaggccagagggtctc
agaccagaggcgcccagaccagtggacatcagttccagaagattcagtgatgtccgtgct
caggagggactgaggggaaacgccgatttggtatacgtcctgaacgcagacccctgtggc
cactgcctcattatcaacaacgtgcacttctgcctcaagtcggggctcagcacccgcccc
ggctccgacgtcgactgtgagaagttgcagcgacgcttccgcttgttacatttcatggtg
gaggtgaagtgcgacctgactggcaagcaaatagtccaggctttggtggagctggcacag
cgggaccacggcgcactggactgctgtgtggtggtcatcctctctcacggctgccaggcc
agccacctccagttcccgggggctgtttacggcacagatgggtttcttgtgtccatcgag
aaaatcgtgaacatcttcaacggaaccggctgccccagcttgggagggaagcccaagctc
tttttcatccaggcctgtggtggagagcggaaagactgtgggtttgcggtggtctccact
tcccctgaggacagggcccccggcagcaaccctgagccagacgctgtgccattccaggac
cgttcaggcagctgtgaccagccggatgctgtgtctaatttgcccacaccgagtgacatc
tttgtgtcctactctaccttcccaggctttgtctcgtggagggaccccaaaagtggctcc
tggtacatcgagaccctggacaacatctttgagcagtgggctcactctgaagacctgcat
agcctcctgctgagggtcgctaatgctgtctcgcaaaaagggatttacaaacagattcct
ggctgtttcaactttctccggaaaaaactcttttttaaaacttcatga

DBGET integrated database retrieval system