KEGG   Pteropus alecto (black flying fox): 102878621
Entry
102878621         CDS       T02993                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102878621 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102878621 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102878621 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102878621 (THPO)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102878621 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102878621
NCBI-ProteinID: XP_006925855
LinkDB
Position
Unknown
AA seq 353 aa
MELTELLLVVVLLLSTRLTWSSPAPPACDPRLLNKLLRDSHVLQGRLSQCPDVNPLSSPV
LLPAVDFSLGEWKTQTEQTKAQDVLEATTLLLEGVMAARGQLGPSCLSSLLGQLSGQVRL
LLGALQGLLGTQLPPQGRTTAHRDPNAIFLSFQQLLRGKVRFLLHVVGPTICAKRTLLTT
AVPSSTFLFLTLNKLPNRTSGLLETNSSVSARATGSGLLKRLQGLRAKIPGLLNQTSRFL
EQIPGDLNRTHRPLNGTHGLFPGPSPRALGALNIPPGTSDTGSLPPDLRPGYSPPLTHPP
TGQYTLFSPPRTLPTPTVQLQLPLPDPSAIMPNITSPLLIAAHPHFHNLSQEE
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagctgactgaactgctcctcgtggtcgtgcttctcctaagtacaagactaacttgg
tccagcccggctcctcctgcctgtgacccaagactcctaaataaactgcttcgtgattcc
catgtccttcagggcagactgagccagtgcccagacgttaaccctttgtcctcacctgtc
ctgctgcctgctgtggattttagcttgggagaatggaaaacccagacggagcagaccaag
gcacaagatgttctggaagcgacgacccttctgctagagggagtgatggcagcacgggga
caactgggaccctcttgcctctcatccctactgggacagctttctggacaggtccgcctc
ctccttggggccctgcagggtctacttggaacccagcttcctccacagggcaggaccaca
gctcacagagaccccaatgccatcttcctgagcttccaacaactgctccgaggaaaggtt
cgtttcctgctgcatgtagtagggcccaccatctgtgccaagcgcaccctactcaccaca
gctgtcccaagcagtacctttctattcctcacactgaacaagctcccaaacaggacttct
ggattgttggagacaaactccagtgtgtcagccagagctactggttctggacttctgaag
aggctgcagggactcagagccaaaattcctggtctgcttaaccaaacttccaggtttcta
gagcaaattcctggagacctgaacaggacacaccgacccttgaatggaactcatggactc
tttcctggaccctcacccagggccctgggagccttgaatattcctccaggaacttcagac
acaggctccctgccacccgacctccggcctggatattctcctcccctaacccatccaccc
actggacaatatacactcttctctcctccacgcaccttgcccacccccacggtccagctt
caactcccacttcccgacccttctgctattatgcccaacattaccagtcctcttctaatt
gcagcccaccctcacttccataatctgtctcaggaagagtaa

KEGG   Pteropus alecto (black flying fox): 102882020
Entry
102882020         CDS       T02993                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor isoform X1
  KO
K05423  granulocyte colony-stimulating factor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04657  IL-17 signaling pathway
pale05144  Malaria
pale05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102882020 (CSF3)
   04151 PI3K-Akt signaling pathway
    102882020 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102882020 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102882020 (CSF3)
   04657 IL-17 signaling pathway
    102882020 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102882020 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    102882020 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102882020 (CSF3)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102882020 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6 NAGLU Sigma54_AID
Other DBs
NCBI-GeneID: 102882020
NCBI-ProteinID: XP_006924747
UniProt: L5JTJ0
LinkDB
Position
Unknown
AA seq 195 aa
MKLMALQLLLWHSVLWTVQEATPLGPASNLPQSFLFKCLEQVRKIQADGVVLQERLCATH
NLCHPEELVLLGHSLGISQAPLSSCSSQALQLTGCLRQLHSGLFLYQGFLQALAGISPKL
APTLDMLHLDIADLATNIWQQMEDLGVAPAVQATQGTMPIFTSAFQRRAGGVLVAANLQS
FLELAYRVLRYLAEP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgatggccctgcagttgctgctctggcacagtgtactttggacagtgcaagaa
gccacccccttgggccctgccagcaacctgccccagagcttcctgttcaagtgcttagag
caagtgaggaagatccaggccgatggtgtggtgctgcaggagaggctgtgtgccacccac
aacctgtgccaccctgaggagctggtgctgcttggacattctctgggcatttcccaggct
cccctgagcagctgctccagccaggccctgcagctgacgggctgcctgagacaactccac
agcggcctcttcctctaccagggctttctgcaggccctggcagggatctcccccaagtta
gctcccaccctggacatgctgcatctggacatcgccgaccttgccaccaacatctggcag
cagatggaagacctgggggtggcccctgccgtgcaggccacccagggcaccatgccaatc
ttcacctcagccttccagcgccgagcaggaggtgtcctggttgctgccaacctgcagagc
ttcctggagctggcataccgtgttctgcgctaccttgccgaaccctga

KEGG   Pteropus alecto (black flying fox): 102883166
Entry
102883166         CDS       T02993                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04066  HIF-1 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102883166 (EPO)
   04066 HIF-1 signaling pathway
    102883166 (EPO)
   04151 PI3K-Akt signaling pathway
    102883166 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102883166 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102883166 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102883166 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102883166 (EPO)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102883166 (EPO)
SSDB
Motif
Pfam: EPO_TPO CTX_RstB
Other DBs
NCBI-GeneID: 102883166
NCBI-ProteinID: XP_006918668
LinkDB
Position
Unknown
AA seq 193 aa
MGVRECPALLLLLSLLLLPLGLPVLGAPPRLICDSRVLERYILEAKEAENVTVGYGEGCS
FSENITVPDTKVNFYAWKRMEIEQQAVEVWQGLALLSEAILRGQGLLANSSQPSEILQLH
VDKAISSLRSLTSLLRALGAQKEAISFPEATASAAPLRTFTVDTLCKLFRIYSNFLRGKL
KLYTGEACRRGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcgcgaatgtcctgccctgctgctcctgctgtccttgctgctgcttcctctg
ggcctcccagtcctgggcgctcccccacgcctcatctgtgatagccgagtcctggagagg
tacatcctggaggccaaggaggctgaaaatgtcacggtgggctatggggaaggctgcagc
ttcagtgagaatatcaccgtcccagacaccaaggttaacttctatgcctggaagaggatg
gagattgagcagcaggccgtggaagtctggcagggcctggccctgctctcagaagccatc
ctgcgaggacagggcctgttggccaactcctcccagccatctgagatcctgcagctacat
gtggacaaagccatcagtagcctacgcagcctcacctccctacttcgggcgctgggagcc
cagaaggaagccatctcctttccagaagcaacagcatctgctgctccactccgaacattc
actgttgatactttgtgcaaacttttccgaatctactccaatttccttcggggaaagctg
aagctgtacacaggggaggcctgcaggagaggggacaggtga

KEGG   Pteropus alecto (black flying fox): 102887064
Entry
102887064         CDS       T02993                                 

Gene name
PRL
Definition
(RefSeq) prolactin isoform X1
  KO
K05439  prolactin
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04080  Neuroactive ligand-receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102887064 (PRL)
   04151 PI3K-Akt signaling pathway
    102887064 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102887064 (PRL)
   04060 Cytokine-cytokine receptor interaction
    102887064 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102887064 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102887064 (PRL)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102887064 (PRL)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 102887064
NCBI-ProteinID: XP_006909293
LinkDB
Position
Unknown
AA seq 230 aa
MENKGLSLKAGSLLLLLLLVSNLLLCKSVDSLPICSSGAVNCQVSLRDLFDRAVVLSHYI
HNLSSEMFNEFDKRYAQGRGFITKTINSCHTSSLSTPEDKEQAQQINHEDLLNLVLRVLR
SWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKQLLEGMEKIVGQVHPGVKENEVYSV
WSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYNSNC
NT seq 693 nt   +upstreamnt  +downstreamnt
atggaaaacaaagggttgtcactgaaagcagggtcactcctactgctgctgctgctggtg
tcaaacctgctcctgtgcaagagtgtagactccctgcccatctgttccagtggggctgtc
aactgccaagtgtccctccgagacctgtttgaccgtgcagtcgtcctctctcactacatc
cacaatctctcctcagaaatgttcaacgaatttgataaacggtatgcccagggcagaggg
tttattaccaagaccatcaacagctgccacacttcttccctctctacccctgaggacaag
gagcaagcccaacagatcaatcacgaagacctcctgaacctggtactcagagtgttgcgt
tcctggaatgaccctctgtatcatctagtcacagaagtgcgtggtatgcaagaagccccg
gatgctatcctgtctagagcaatagagattgaggaacaaaacaaacagcttctagagggc
atggagaagatagtcggccaggttcatcctggagtcaaagaaaacgaggtctattctgtc
tggtcaggacttccatcgttgcagatggccgatgaagacactcgcctttttgctttttat
aacctgctccactgcctacgcagggattcacataagattgacaactatctcaagctcctg
aagtgccgaatcatatataacagcaactgctaa

KEGG   Pteropus alecto (black flying fox): 102888823
Entry
102888823         CDS       T02993                                 

Definition
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04080  Neuroactive ligand-receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04630  JAK-STAT signaling pathway
pale04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102888823
   04151 PI3K-Akt signaling pathway
    102888823
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102888823
   04060 Cytokine-cytokine receptor interaction
    102888823
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102888823
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102888823
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102888823
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 102888823
NCBI-ProteinID: XP_006912488
LinkDB
Position
Unknown
AA seq 257 aa
MATVSGGRRRERDGPSGKEKAGRRPRLPALSAPALNLTSVSLSPGPRTSMLLAFTLLCLP
WPQAVDAFPTMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCF
SETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLK
DLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAET
YLRVMKCRRFVESSCPF
NT seq 774 nt   +upstreamnt  +downstreamnt
atggctacagtctctgggggaaggcggagagagagggatgggccctcgggcaaggagaag
gctggcaggagacctaggcttcctgctctgtcggcccctgcccttaatttgacttctgtg
tctctctctccaggccctcggacctccatgctcctggctttcaccctgctctgcctgccc
tggcctcaggcagtggacgccttccccaccatgcccttatccagcctgtttgccaacgct
gttctccgggcccagcacctgcaccaactggctgctgacacctacaaggagtttgagcga
gcgtacatcccggagggacagagatattcgatccagaacgcccaggctgccttctgcttc
tcggaaaccatcccagcccccacgggcaaggacgaggcccagcagagatccgacatggag
ctgctccgcttctcgctgctgctcatccagtcctggctcgggccggtgcaattcctcagc
agggtcttcaccaacagcctggtgtttggcacctcagaccgcgtctatgaaaagctgaag
gacctggaggaaggcatccaagccctgatgcgggagctggaggatggcagtcctcgggct
gggcagatcctcaagcaaacctatgacaagtttgacacaaacctgcgtagtgatgatgca
ctcctcaagaactacgggctgctctcttgcttcaagaaggacttgcacaaggctgagaca
tacctgcgggtcatgaagtgtcgccgcttcgtggaaagcagctgtcccttctag

KEGG   Pteropus alecto (black flying fox): 102895952
Entry
102895952         CDS       T02993                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895952 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102895952 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102895952 (CNTF)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102895952 (CNTF)
SSDB
Motif
Pfam: CNTF DUF3719 Neurexophilin
Other DBs
NCBI-GeneID: 102895952
NCBI-ProteinID: XP_006918854
UniProt: L5K866
LinkDB
Position
Unknown
AA seq 200 aa
MAFAEHSLLTPHRRDLCSRSIWLARKMRSDLTALTESYVKHQGLNENINLDSVDGVPTAS
TDRWGELTEAERLRENLQAYRTFHVMLTRLLEDQRVHFSPAEGDFHQAIHTLLLQVAAFT
YQLEELMALLEHKIPHNEADGLPVIAGEGGLFEKKLWGLKVLQELSQWTVRSIHDLRVIS
SHQIGISAHGSHYVANDKKM
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctttcgcagagcactccctgctgacccctcaccgccgggacctgtgtagccgctct
atctggctagcgaggaagatgcgttcagacctgactgctcttacggaatcttatgtgaag
catcagggcctgaacgagaacataaacctggactctgtggacggtgtgccaacggcgagc
actgaccggtggggcgagctgactgaggccgagagactccgagagaacctccaagcctat
cgtaccttccacgtgatgttgaccaggcttttagaagaccagcgagtgcatttttctcca
gctgaaggtgacttccatcaagcaatacacacccttctgctccaggttgctgccttcact
tatcagctggaggaattgatggcgctcctggaacacaagatcccccacaacgaggccgac
gggctgcccgtcattgctggagaaggtggtctctttgagaagaagctgtggggcctgaag
gtgctgcaggagctttcccagtggacggtgaggtccattcacgaccttcgagtcatttct
tctcatcagatcgggatctcagcacatggaagccactatgtcgccaacgacaagaaaatg
tag

KEGG   Pteropus alecto (black flying fox): 102896937
Entry
102896937         CDS       T02993                                 

Gene name
LEP
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04080  Neuroactive ligand-receptor interaction
pale04152  AMPK signaling pathway
pale04630  JAK-STAT signaling pathway
pale04920  Adipocytokine signaling pathway
pale04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102896937 (LEP)
   04152 AMPK signaling pathway
    102896937 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102896937 (LEP)
   04060 Cytokine-cytokine receptor interaction
    102896937 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102896937 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102896937 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102896937 (LEP)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  CSF and other factors
   102896937 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 102896937
NCBI-ProteinID: XP_006910607
LinkDB
Position
Unknown
AA seq 167 aa
MHCGLLCRFLWLWPFLFYIEAMPIRKVQDDTKILIKTIVTRINDISHTQSVSSKQKVTGL
DFIPRLHTALTLSKMDQTLAIYQQILTTLSSRNVIQISNDLENLRDLLHLLASFRSCPFP
RASSPKTLKGLGDVLETSFYSTEVVALSRLQGFLQDMLQQLDFSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcattgtggactcctgtgccgattcctgtggctttggccctttctcttctacattgaa
gctatgcccatccgaaaagtccaggatgacaccaaaattctcatcaagacgattgtcacc
aggatcaatgatatttcacacacgcagtcggtctcctctaaacagaaggtcactggtttg
gacttcattcctcggctccacactgctctgactttgtccaagatggaccagacattagca
atctaccaacagatcctcaccactctgtcttccagaaacgtgatccaaatatctaacgac
ctagagaacctccgggaccttctccatctgctggcctccttcagaagctgtcccttcccc
cgggccagcagcccgaagaccttgaagggcctgggtgatgtcctagaaacctcgttctac
tccacagaggtggtggccctgagcaggctgcaggggtttctgcaggacatgctacagcag
ctggacttcagccctgggtgctga

DBGET integrated database retrieval system