KEGG   Pteropus alecto (black flying fox): 102878735
Entry
102878735         CDS       T02993                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04120  Ubiquitin mediated proteolysis
pale04380  Osteoclast differentiation
pale04630  JAK-STAT signaling pathway
pale04910  Insulin signaling pathway
pale04917  Prolactin signaling pathway
pale04930  Type II diabetes mellitus
pale04935  Growth hormone synthesis, secretion and action
pale05145  Toxoplasmosis
pale05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102878735 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102878735 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102878735 (SOCS1)
   04917 Prolactin signaling pathway
    102878735 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    102878735 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102878735 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102878735 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102878735 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102878735 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102878735 (SOCS1)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102878735 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 102878735
NCBI-ProteinID: XP_006910948
UniProt: L5KRF6
LinkDB
Position
Unknown
AA seq 215 aa
MVAHNQVAADNAISTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVAVPVPAPTPGDTHFR
TFRSHAEYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALS
VKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQE
LCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcaatctccacggcagcagagccccga
cggcggccagagccttcctcctcctcctcctcctctcccgcggccccggcgcgcccgagg
ccctgtcccgcggtcgcggtcccggtcccggccccgaccccgggcgacacgcacttccgc
acgttccgatcgcacgccgagtaccggcgcatcacccgcgccagcgcgctcctcgacgcc
tgcggcttctactggggacccctgagcgtgcacggggcgcacgagcggctgcgcgccgag
cccgtgggcaccttcctggtgcgcgacagccgccagcggaactgcttcttcgccctcagc
gtgaagatggcctcgggccccacgagcatccgcgtgcacttccaagccggccgcttccac
ctggacggtagccgcgagagcttcgactgcctctttgagctgctcgagcactacgtggcg
gcgccgcgccgtatgctgggggccccgctgcgccagcgccgcgtgcggccgctgcaggag
ctgtgtcgccagcgcatcgtggccacggtgggccgcgagaacctggcgcgcatccccctc
aatcccgttctgcgcgactacttaagctccttcccctttcagatttga

KEGG   Pteropus alecto (black flying fox): 102879275
Entry
102879275         CDS       T02993                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
pale04910  Insulin signaling pathway
pale04917  Prolactin signaling pathway
pale04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102879275 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102879275 (SOCS4)
   04917 Prolactin signaling pathway
    102879275 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102879275 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102879275 (SOCS4)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102879275 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 102879275
NCBI-ProteinID: XP_006920226
UniProt: L5K440
LinkDB
Position
Unknown
AA seq 441 aa
MAENSENNSKDLDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDVETVNAIEKTEV
PLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDELVSTDLSQSELRDGRLKQRR
NMEEEVTCFSHPSVQPCVITTNNASCRSGPMTGSVMNLVSNNCIEDSDMDSDDEIITLCT
SSRKRNKPKWEMDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEAL
LEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITG
LLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPTSMKLYL
KEYHYKSKVRVLRIDAPEQQC
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggcagaaaatagtgaaaataatagtaaagatttagatgtaaggcccaaaactagtcgg
agtagaagtgctgacagaaaggatggatatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgaaagttgttcagatgttgaaacagtgaatgctatagagaaaactgaagtt
cctttaaggagccaagaaagaaagcacagctgttcatccatcgagttggatttagatcat
tcctgtgggcatagatttttaggccgatctcttaaacagaaattgcaagatgctgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttcagggcttccatctaaaaga
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctagatcagactta
gcctttaggtggcattttattaaacgacatactgctcctataaattccaaatcagatgaa
ttggtaagcacagacttgtctcagagtgaattgagggatggtcggctaaaacaaagaaga
aacatggaagaagaggtgacctgtttctcacatcccagtgttcagccctgtgtcataact
accaacaatgcttcatgtagaagtggtcctatgactggctctgtgatgaacttggtttca
aataactgtatagaagacagtgatatggattcagatgatgaaattataacactttgcaca
agttccaggaaaagaaataaacccaaatgggaaatggatgaagaaatcctgcaattggaa
acacctcctaagtatcacacccagattgattatgtccactgtcttgtaccagacctcctt
cagatcaataacaatccatgttactggggagttatggataaatatgcagctgaagctcta
ctagaaggaaaaccagagggtacctttttacttcgagactcagcacaggaagactattta
ttctctgttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaat
cacaactttagctttgatgcacatgatccttgtgtcttccattctcctgacataactggg
ctcctagaacactataaggacccaagtgcctgtatgtttttcgaaccacttttatccact
cctttaattcggactttccccttttccctgcagcatatatgcagaacagttatttgtaac
tgtacaacttatgatggcattgatgcccttccaattcctacttctatgaaattatatctg
aaggaatatcactataaatctaaagttagagtactcaggattgatgcaccagaacaacaa
tgctag

KEGG   Pteropus alecto (black flying fox): 102887834
Entry
102887834         CDS       T02993                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04120  Ubiquitin mediated proteolysis
pale04380  Osteoclast differentiation
pale04630  JAK-STAT signaling pathway
pale04668  TNF signaling pathway
pale04910  Insulin signaling pathway
pale04917  Prolactin signaling pathway
pale04920  Adipocytokine signaling pathway
pale04930  Type II diabetes mellitus
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04935  Growth hormone synthesis, secretion and action
pale05160  Hepatitis C
pale05164  Influenza A
pale05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102887834 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102887834 (SOCS3)
   04668 TNF signaling pathway
    102887834 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102887834 (SOCS3)
   04920 Adipocytokine signaling pathway
    102887834 (SOCS3)
   04917 Prolactin signaling pathway
    102887834 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    102887834 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102887834 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102887834 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    102887834 (SOCS3)
   04931 Insulin resistance
    102887834 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102887834 (SOCS3)
   05164 Influenza A
    102887834 (SOCS3)
   05168 Herpes simplex virus 1 infection
    102887834 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102887834 (SOCS3)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102887834 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 102887834
NCBI-ProteinID: XP_006912237
UniProt: L5KLX1
LinkDB
Position
Unknown
AA seq 228 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPSAPSFPSPPSEPSSPSAEVPEQTPAQPLPGTPPRRAYYIYSGGEKIPLV
LSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 687 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcggtgacgggcggcgaggcgaacctgctgctc
agcgccgagcccgccggcaccttcctcatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtcggggaccaagaacctgcgcatccagtgcgaggggggc
agcttctcgctgcagagcgacccccggagcacgcagcctgtgccgcgcttcgactgcgtg
ctcaagctggtgcatcactacatgccgccccccagcgcgccctccttcccgtcgccaccg
agtgaaccctcctcgccctccgccgaggtgccagaacagacgcccgcccagccgctgccg
gggacgccccccaggagagcctattacatctactcggggggcgagaagatccctctggtg
ttgagcaggcccctctcctccaacgtggccactctccagcatctctgtcggaagaccgtc
aacggccacctggactcctatgagaaagtcacccagctgcctgggcccattcgggagttc
ctggaccagtacgatgccccactttaa

KEGG   Pteropus alecto (black flying fox): 102888661
Entry
102888661         CDS       T02993                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
pale04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102888661 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102888661 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102888661 (SOCS6)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102888661 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 102888661
NCBI-ProteinID: XP_024903894
LinkDB
Position
Unknown
AA seq 317 aa
MKKISLKTFRKSFNLNKSKEEAEFMVVQPPSLAGGFDKDGSLFGSCYGKDMAACDINGDD
EKGGKTRSKSESLMGTLKRRLSAKQKAKGKGGAPPGRAADEDTFSSASAPLVATGRTWPP
ATSTNLNFDPSSAPGVARVYDAVQGSGPLAVTSLTEELKKLAKQGWYWGPITRWEAEGKL
ASVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLI
EHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQ
KLPLPNKMKDYLQEKHY
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtctgaaaaccttccggaaatctttcaacttgaataaaagcaaagaa
gaagcggagttcatggtagtgcagccaccctcgctagccggcggtttcgacaaagacggt
tccttgtttggtagctgctacgggaaggacatggccgcctgcgacatcaacggcgacgac
gagaagggggggaaaacgagatcaaagagcgagagcctgatgggcaccttgaaaagacgg
ctgtcggcgaagcagaaggcgaagggcaagggcggcgcgccgccggggcgcgcggccgac
gaggacaccttctcctcggcgtcggcgccgctcgttgctacgggaaggacatggccgcct
gcgacatcaacgaacctgaacttcgaccccagctcggcgcccggggtcgcgcgcgtgtac
gacgcggtgcagggcagcgggccgctggccgtgaccagcctcaccgaggagctgaagaag
ctggcgaagcagggctggtactggggccccatcacgcgctgggaggccgagggcaagctg
gccagcgtgcccgacggctcgttcctcgtgcgcgacagctcggacgaccgctatctgctg
agcctgagcttccgctcccacggcaagacgctgcacaccagaatcgaacattccaacggg
cgcttcagcttctacgaacagccggacgtggagggccacacgtccatcgtggacctcatc
gagcactccatccgggactccgaaaacggagccttctgctactcgcgctcgcggctgccg
ggctctgcgacttaccccgtcagactgaccaaccccgtgtcgcggttcatgcaggtgcgc
tccttgcagtacctgtgccggttcgttatacgtcagtacaccaggatagacctaattcag
aaactgcctctgccaaacaaaatgaaggattacttacaggagaagcactactga

KEGG   Pteropus alecto (black flying fox): 102889529
Entry
102889529         CDS       T02993                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
pale04910  Insulin signaling pathway
pale04917  Prolactin signaling pathway
pale04930  Type II diabetes mellitus
pale04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102889529 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102889529 (SOCS2)
   04917 Prolactin signaling pathway
    102889529 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    102889529 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102889529 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102889529 (SOCS2)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102889529 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 102889529
NCBI-ProteinID: XP_006923893
LinkDB
Position
Unknown
AA seq 198 aa
MTLRCLEPSGNGAEGTRSQWGTAGSAEEPSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYHDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcgcggaagggacgcggagtcagtgg
gggaccgcggggtcggcggaggagccctcccccgaggcggcgcgtctggcgaaggccttg
cgggaactcagtcaaacaggttggtactggggaagtatgactgttaacgaagccaaagaa
aaattaaaagaggcaccagaaggaactttcttgattagagatagttcgcattcagactac
ctactaacaatatctgttaaaacatcagccggaccaactaatctgcgaatcgaataccac
gatgggaaattcagattggactctatcatatgtgtcaagtccaagcttaaacagtttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacgggccca
gaagccccccggaatggcactgttcacctttatctgaccaaaccgctctacacatcagca
ccacctctgcagcatctctgtagactcaccattaacaaatgtaccggtaccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Pteropus alecto (black flying fox): 102893297
Entry
102893297         CDS       T02993                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7 isoform X2
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
pale04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102893297 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102893297 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102893297 (SOCS7)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102893297 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 102893297
NCBI-ProteinID: XP_006924795
LinkDB
Position
Unknown
AA seq 544 aa
MVFRNVGRPPEEEDAQAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQL
AALGLGQPAGPGVKTVGGSCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGSGRLLLQPPGPELPPVSFPLQDLVPPGRLSRGEQ
QQLPPPPPPPPPGLLRPLAGPSRKGSLKIRLSRLFRTKSCNGGSGGGDGVGKRPSGELAA
SAASLTDVGGSAGRELDVVRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSP
HPPTPPPPPRRSLSLLDAFPRIAPIRAVESLHSQPPQHLQCPLYRPDSSSFAASLRELEK
CGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFS
LWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKS
LQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEV
EPST
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggtgttccgcaacgtgggtcggccgccggaggaggaggacgcccaggcggcgccggag
ccgggaccctcggaactgctgtgtccccggcaccgctgtgccctggaccccaaggccctg
cccccggggttggcactcgagcggacctggggcccggcggccggactagaggcgcagttg
gctgctctggggctcgggcagcctgcagggccgggagtcaagacggtgggtgggagttgc
tgcccgtgcccgtgccccccacagccgccccctccgcagccccaaccgcctgctgccgcc
ccgcaggccggggaggatcctacggaaacgagcgacgcgctgctagtcttggagggcttg
gagtcggaggccgagagcctggagactaacagctgctcagaagaagagctcagcagcccg
ggccgcggaggaggagggagcggccggcttctgctgcaacccccaggccctgaattaccc
ccggtgtccttcccgctgcaggacttggtccctccagggcgcttaagtagaggggagcaa
cagcagctgcctcccccgccgccgccgccgcctcctgggctcctccggccactcgcgggc
ccttctcgaaagggctctctcaaaatccgcctcagccgtctctttcgcacgaagagttgc
aacggtggctccggtggtggggatggggtcggcaagagaccttctggggagctcgctgct
tcagcggcgagcctgacggacgtgggaggttctgccggccgggagctcgacgtggtgagg
aaacccaggttgacaagaactcaaagtgccttttctccggtctccttcagccccctgttc
acaggtgaaacagtgtcgcttgtggatgtggacatctctcagcggggcctgacctctcca
caccctccaactccccctcctcctccaagaagaagcctcagcctcctagatgcatttccc
cggattgctcccatcagagcagttgagtccctgcacagccagcccccccaacacctccag
tgtcccctctaccggcctgactcaagcagctttgcagccagtttgcgagaattggagaag
tgtggttggtattggggaccaatgaattgggaagatgcagagatgaaactgaaagggaag
ccagatggttctttcttggtacgagacagctctgatcctcgttatatactgagcctcagc
ttccgatcacagggtatcacccaccacaccagaatggagcactacagaggaactttcagc
ctttggtgtcatcccaagtttgaggatcgctgtcaatcagtggtggagttcattaagaga
gccattatgcactccaagaatgggaagtttctctatttcttgagatccagggttccagga
ctgccaccaactccagttcagctgctctatccagtgtcccgattcagcaatgtcaaatcc
ctccagcacctttgcagattccgaatccgacagctcgtccggatagatcacatcccggat
ctcccactgcctaaacctctgatctcttatatccgaaagttctactactatgatcctcag
gaagaggtatacctgtctctaaaggaagctcagctcatttccaaacagaagcaagaggta
gaaccttccacgtag

KEGG   Pteropus alecto (black flying fox): 102895579
Entry
102895579         CDS       T02993                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
pale04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895579 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102895579 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102895579 (SOCS5)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102895579 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Other DBs
NCBI-GeneID: 102895579
NCBI-ProteinID: XP_006909684
UniProt: L5KTH9
LinkDB
Position
Unknown
AA seq 533 aa
MDKVGKMWNNFKYRCQNFFSHEGGSRSENVDMNSSRCLPVREKNSSMEDSAPQQQSSPLR
ENIALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLTRRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRSRSLRQRLQD
TVGLCFPMRTYNKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPH
STFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKL
APGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVHTQI
DYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYN
RSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFS
LQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataacttcaaatacaggtgtcagaatttcttcagt
catgagggaggaagccgtagtgaaaatgtggacatgaactctagcagatgtttgcccgtg
agagagaaaaacagcagtatggaagactccgctcctcagcaacaaagtagtcccttaaga
gaaaacattgccttacaactgggattaagcccttcaaagaattcttcaaggagaaaccaa
aactgtgctactgaaattcctcagattgttgaaataagcattgaaaaagataatgattcg
tgtgtcaccccaggaacaagacttacaagaagagattcctactctcgacatgctccatgg
ggtgggaagaagaaacattcctgttctacaaagacacagagttcactggatactgataaa
aagtttggtagaactcgaagtggacttcaaaggagagagaggcgctatggcgtcagctct
gtacatgatatggacagcgtgtccagcagaagtcgctctctgagacagaggttgcaggat
actgtgggcttgtgttttcccatgagaacttacaacaagcagtcgaagcctctcttttct
aataaaagaaaaatacacctttctgaattgatgcttgagaaatgcccttttcctgctggc
tcagatttagcccaaaaatggcatttgattaaacagcatacagcccctgtgagcccacat
tcaacattttttgatacatttgatccatccttggtttctacagaggacgaagaagatagg
ctgagagagagaagacggcttagtattgaagaaggggttgacccccctcccaatgcacaa
atacatacatttgaagccactgcacaggtcaatccgttgtataaactgggaccaaagtta
gctcctggaatgactgaaatcagtggagacagttctgcaattccacaagctaattgtgac
tcagaagaggacacaaccaccctgtgtttgcagtcacgtagacagaagcaacgtcaggta
tctggagacagccacgcccacgtcagcagacagggagcttggaaagtccacacacagatt
gattacatacactgcctcgtgcccgatttgcttcagattacaggtaatccctgttactgg
ggagtgatggaccgttatgaagcagaagcccttctcgaagggaaacctgaaggcacattt
ttgctcagggactctgcgcaggaggactacctcttctctgtgagcttccgtcgctacaac
agatccctgcatgcccgaattgaacaatggaatcacaactttagtttcgatgctcatgac
ccatgtgtatttcactcctccactgtaacaggacttttggaacactataaagatcccagt
tcttgcatgtttttcgaaccattgcttactatctcactaaataggactttcccttttagc
ctgcagtatatctgccgtgcagtaatctgcagatgcactacatatgatggcattgatggg
ctgcctttaccatcaatgttacaggattttttaaaagagtatcattataaacaaaaagtt
agagttcgctggttagaacgagaaccagtcaaggcaaagtaa

DBGET integrated database retrieval system