KEGG   Pteropus alecto (black flying fox): 102878861
Entry
102878861         CDS       T02993                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04114  Oocyte meiosis
pale04151  PI3K-Akt signaling pathway
pale04390  Hippo signaling pathway
pale05160  Hepatitis C
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102878861 (YWHAH)
   04151 PI3K-Akt signaling pathway
    102878861 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102878861 (YWHAH)
   04114 Oocyte meiosis
    102878861 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102878861 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102878861 (YWHAH)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102878861 (YWHAH)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102878861 (YWHAH)
Exosome [BR:pale04147]
 Exosomal proteins
  Proteins found in most exosomes
   102878861 (YWHAH)
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 102878861
NCBI-ProteinID: XP_024903633
LinkDB
Position
Unknown
AA seq 261 aa
MLVGLRCEGSRDKSFSLSSGGSWADFFSRFLNLDLSVYLSGILQVTELNEPLSNEDRNLL
SVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLD
KFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHM
QPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQL
LRDNLTLWTSDQQDEEAGEGN
NT seq 786 nt   +upstreamnt  +downstreamnt
atgctggtagggttgcgctgtgaaggctctagagacaaatccttctctctcagctctggt
ggctcctgggcagatttcttttcaagatttttgaacttggatctcagtgtttatctttct
gggattttgcaggtgacagaactcaatgaacctctctccaacgaagatcgaaacctcctc
tccgttgcctataagaatgtggttggtgccaggcggtcttcctggagggtcatcagcagc
attgagcagaaaaccatggctgatggaaacgaaaagaagttggagaaggttaaagcttat
cgggagaagattgagaaggagctggaaacagtatgcaacgatgtcctggctctgctcgac
aagttcctcatcaagaactgcaatgatttccagtacgagagcaaggtattttatctgaaa
atgaaaggcgattactaccgctacttggcagaggtagcttctggggagaagaaaaacagt
gtggtcgaagcttctgaggcggcctacaaggaagcctttgaaattagcaaagagcacatg
cagccaacgcaccccatccggctgggcctggccctcaacttctccgtgttctactacgag
atccagaatgcacccgagcaggcctgcctcttagccaaacaagccttcgatgatgccata
gccgagctggacacactaaatgaggattcctataaggactccacgctcatcatgcagtta
ctgcgagacaaccttaccctctggacgagcgaccagcaggatgaggaagcaggagaaggc
aactga

KEGG   Pteropus alecto (black flying fox): 102880620
Entry
102880620         CDS       T02993                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04114  Oocyte meiosis
pale04151  PI3K-Akt signaling pathway
pale04390  Hippo signaling pathway
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102880620 (YWHAB)
   04151 PI3K-Akt signaling pathway
    102880620 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102880620 (YWHAB)
   04114 Oocyte meiosis
    102880620 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102880620 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102880620 (YWHAB)
   05160 Hepatitis C
    102880620 (YWHAB)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102880620 (YWHAB)
Exosome [BR:pale04147]
 Exosomal proteins
  Proteins found in most exosomes
   102880620 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 102880620
NCBI-ProteinID: XP_006921904
LinkDB
Position
Unknown
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataaaagtgagctggtacagaaagccaaactcgccgagcaggctgagcgc
tatgatgatatggctgcagccatgaaggcagtcacagaacaggggcacgaactttccaat
gaagagagaaatctgctctccgtcgcctataagaacgtggtaggcgcccgccgttcttcc
tggcgtgtcatctccagcattgaacagaaaacagagaggaatgagaagaagcagcagatg
ggcaaagagtaccgcgagaagatagaggcagaactgcaggacatctgcaacgatgttctg
gagctgttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggagattattttagatatctttctgaggtggcatctggagacaataaa
caaaccactgtttcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaa
gaaatgcagcctacacacccaattcgacttggcctggcactgaatttctcagtcttttac
tatgagattctgaactctcctgaaaaggcttgcagcttggcaaaaacggcatttgatgaa
gcaattgctgaattggacacgctgaatgaagagtcgtacaaagacagcaccctgatcatg
cagttgcttagggacaatctcactctctggacgtcggaaaaccagggagatgaaggagat
gctggggaaggagagaactaa

KEGG   Pteropus alecto (black flying fox): 102885303
Entry
102885303         CDS       T02993                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon isoform X1
  KO
K06630  14-3-3 protein epsilon
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04114  Oocyte meiosis
pale04151  PI3K-Akt signaling pathway
pale04390  Hippo signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04722  Neurotrophin signaling pathway
pale05160  Hepatitis C
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102885303 (YWHAE)
   04151 PI3K-Akt signaling pathway
    102885303 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102885303 (YWHAE)
   04114 Oocyte meiosis
    102885303 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102885303 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102885303 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102885303 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102885303 (YWHAE)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102885303 (YWHAE)
Exosome [BR:pale04147]
 Exosomal proteins
  Proteins found in most exosomes
   102885303 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 102885303
NCBI-ProteinID: XP_006925117
LinkDB
Position
Unknown
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatat
gacgaaatggtggaatcaatgaagaaagtagcaggaatggatgtggagttgacagttgaa
gaaaggaacctcctatcggttgcatataaaaatgtgattggagctagaagagcttcctgg
agaataatcagcagcattgaacagaaagaagaaaacaaggggggagaagacaaactaaaa
atgattcgggagtatcggcaaatggttgagactgaactaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgaatttgccacaggaaatgac
aggaaggaggctgcggagaacagcctagtggcttacaaagccgctagtgatattgcaatg
acagaacttccaccaacgcatcccattcgcttaggtcttgctctgaatttttccgtattc
tactatgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

KEGG   Pteropus alecto (black flying fox): 102893263
Entry
102893263         CDS       T02993                                 

Gene name
YWHAZ
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04114  Oocyte meiosis
pale04151  PI3K-Akt signaling pathway
pale04390  Hippo signaling pathway
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102893263 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    102893263 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102893263 (YWHAZ)
   04114 Oocyte meiosis
    102893263 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102893263 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102893263 (YWHAZ)
   05160 Hepatitis C
    102893263 (YWHAZ)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102893263 (YWHAZ)
Exosome [BR:pale04147]
 Exosomal proteins
  Proteins found in most exosomes
   102893263 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM Peptidase_C98
Other DBs
NCBI-GeneID: 102893263
NCBI-ProteinID: XP_006916706
UniProt: L5KDQ4
LinkDB
Position
Unknown
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALTYSVFYDE
SLNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaacgagctggtgcagaaggccaaactggccgagcaggctgaacgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagctcgtaggtcatcttggagg
gtcgtctcaagtattgagcaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaataccgagagaaaattgaaactgagctaagagatatctgcaatgatgtcctgtctctc
ttggaaaagttcttgattcctaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgttacttggctgaggttgctgctggtgatgataagaaaggg
atcgtggatcagtcacaacaagcataccaggaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagattgggtctggcccttacctactctgtgttctatgatgag
agtctgaactccccggagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggatacccaaggagatgaagctgaagcagga
gaaggaggagaaaattaa

KEGG   Pteropus alecto (black flying fox): 102894826
Entry
102894826         CDS       T02993                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04114  Oocyte meiosis
pale04151  PI3K-Akt signaling pathway
pale04390  Hippo signaling pathway
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102894826 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    102894826 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102894826 (YWHAQ)
   04114 Oocyte meiosis
    102894826 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102894826 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102894826 (YWHAQ)
   05160 Hepatitis C
    102894826 (YWHAQ)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102894826 (YWHAQ)
Exosome [BR:pale04147]
 Exosomal proteins
  Proteins found in most exosomes
   102894826 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 102894826
NCBI-ProteinID: XP_006910288
LinkDB
Position
Unknown
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagacggagctgatccagaaggcgaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctctcggtggcctacaagaacgtggtagggggccgcaggtccgcctggagg
gtcatctcgagcatcgagcagaaaaccgacacctccgacaagaagttgcagctgattaag
gactatcgggagaaagtggagtcggagctgcggtccatctgcaccaccgtcctggaattg
ttggataaatatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattacttccggtaccttgcagaagttgcatgtggtgatgatcgaaaacaa
acgatagataattcccaaggagcttaccaagaggcttttgatataagcaagaaagagatg
cagcccacacacccaattcgtctggggctggctcttaacttttctgtattttactatgag
atccttaataacccagagcttgcctgcacactggctaaaacggctttcgatgaggctatt
gcagaacttgatacactgaatgaagactcttacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacattgtggacatcagacagtgcaggagaagaatgcgatgcggca
gaaggggcagaaaactaa

KEGG   Pteropus alecto (black flying fox): 102895426
Entry
102895426         CDS       T02993                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04114  Oocyte meiosis
pale04151  PI3K-Akt signaling pathway
pale04390  Hippo signaling pathway
pale05160  Hepatitis C
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102895426 (YWHAG)
   04151 PI3K-Akt signaling pathway
    102895426 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102895426 (YWHAG)
   04114 Oocyte meiosis
    102895426 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102895426 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102895426 (YWHAG)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102895426 (YWHAG)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102895426 (YWHAG)
Exosome [BR:pale04147]
 Exosomal proteins
  Proteins found in most exosomes
   102895426 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 102895426
NCBI-ProteinID: XP_006918630
UniProt: L5K6B8
LinkDB
Position
Unknown
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtctaacgaa
gaaagaaaccttctttctgtggcctacaagaatgtagttggggcacgccgttcttcctgg
agggtcattagtagcatcgagcagaagacatctgcagatggtaatgagaagaagatagag
atggtccgtgcttaccgtgaaaaaatagagaaggagttagaagcggtatgtcaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagtgagacccagtatgagagcaaa
gtgttttacctgaagatgaaaggggactattatcgctacctggctgaagtagccactgga
gagaaaagggcgactgtggtggaatcatctgagaaggcctatagcgaagcccatgagatc
agcaaggagcacatgcagcctactcaccccattagattaggcctggctcttaactactcc
gttttctactatgagatccagaatgccccggagcaagcatgccacttggccaagaccgcc
ttcgatgatgccattgccgagctcgacactctcaatgaggactcctacaaggactccact
ctcatcatgcagctcctccgcgacaacctaacgctctggacaagcgatcagcaagatgac
gatggtggagaaggcaacaattaa

DBGET integrated database retrieval system