KEGG   Pteropus alecto (black flying fox): 102878992
Entry
102878992         CDS       T02993                                 

Gene name
MSH3
Definition
(RefSeq) DNA mismatch repair protein Msh3 isoform X1
  KO
K08736  DNA mismatch repair protein MSH3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale03430  Mismatch repair
pale05200  Pathways in cancer
pale05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102878992 (MSH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102878992 (MSH3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102878992 (MSH3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102878992 (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102878992 (MSH3)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     102878992 (MSH3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV
Other DBs
NCBI-GeneID: 102878992
NCBI-ProteinID: XP_006913249
LinkDB
Position
Unknown
AA seq 1126 aa
MPRRKPAHGGFASAGPAPARQAVLSRFFHATGSLKSTSSPAGAAEKTDPDSDSAAPLAST
FPPPSLPRLVAETDRSKKRPLENDGPFKKKAKKAHEKDGQSDSVMSRNPEPKRSLRTKIV
LKSLEKLKEFYCDSALPQNRVQREPLQEGFAVLPKCTDFDDISLLRAKNAISSEDSKSQT
SQKNRTLSDLSHFGSSHGSYENLKKISDSKPSNKRTKSIYTPLESQYIEMKQQQKDAILC
VECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPAHRLFVHVRRLVAKGYKVGVVKQ
TETAALKAIGDNKSSLFSRKLTALYTKSTLIGEDVNPLVKLDDAVNVDEIMTDTSTSYLL
CICENKENLKEKKKGSIFIGIVGVQPATGEVVFDSFQDSASRSELETRILSLQPVELLLP
SHLSEQTEMLIHRATAVSVRDDRIRVERMDNMYFEYSHAFQMVTEFYSNDVVDIKGSQSF
SGIINLEKPVICSLAAIIRYLKEFNLEKVLSKPKNFKQLSGDMEFMTINGTTLRNLEILQ
NQTDKKTKGSLFWVLDHTKTSFGRRKLKKWVTQPLLKLRKINDRLDAVSEVLHSESSVFD
QIENHLRKLPDIERGLCSIYHKKCSTQEFFLIVKALYHLKSEFQALIPAVNSHVQSDLLQ
TFILEIPELLSPVEHYLKILNEQAAKIGDKTELFKDLSDFPLIKRRKDEIQEVTDKIQIH
LQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPADWIKVGSTKAVSRFHSPFVVENY
RHLNQLREQLVLDCNAEWLDFLENFSEHYHSLCKAVHHLATIDCIFSLAKVAKQGDYCRP
TLQEERKIMIKNGRHPVIDVLLGEQDQYVPNSTNLSGDSERVMIITGPNMGGKSSYIKQV
ALITIMAQIGSYVPAEEATIGIVNGIFTRMGAADNIYKGHSTFMEELTDTAEIIRKATSR
SLVIMDELGRGTSTHDGIAIAYATLEHFIRDVKSLTLFVTHYPPVCELEKSYSQQVGNYH
MGFLVNENESKQDPGEEEVPEFVTFLYQITRGIAARSYGLNVAKLADVPEEILKKAASKS
KELEGLVNMKRKRLKCFAKLWTINDAKDLQKWTDQFEVEETTDFSY
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgccgcgccggaagccggcccatggcggcttcgcttctgctggcccagctcctgcaagg
caagcggttttgagcagattcttccacgctacaggaagcctgaaatccacctcctcccca
gcgggtgcggcggagaagacggaccctgactccgactccgcagcgcccctcgcgtccact
ttcccgcctccgtcgctgccacggttggttgcagaaactgacagaagtaaaaagagacca
ctagagaatgatgggccctttaaaaagaaagcaaagaaagcccacgaaaaggatggacaa
agtgattcagtaatgtctaggaaccctgagccaaagagaagtctgaggaccaagattgtt
ttaaagtctctggaaaagttgaaagaattctactgcgattccgcccttcctcaaaataga
gtccagagagagcctcttcaggagggatttgcggttctgccaaaatgtactgattttgac
gatatcagtcttctgcgtgcaaagaatgcaatttcttctgaagattccaaatctcaaact
agtcaaaagaacaggacactttctgatctcagtcattttggatcatcacatggaagttat
gaaaacttaaagaaaatttctgattctaaaccatctaacaaaaggaccaaaagcatctat
acaccattagaatcacaatacatagaaatgaagcagcagcaaaaagatgcaattttgtgt
gtggaatgtggttataagtatagattctttggggaagatgcagagattgcagcccgggag
ctcaatatttattgccatttagatcacaactttatgacagcaagcatacctgctcacaga
ctgtttgttcacgtacgccgccttgtggcaaagggatataaggtaggagttgtgaagcaa
actgaaacagcagcattaaaggccattggagacaacaaaagttcactcttttcccggaaa
ttgactgctctttatacgaaatccacacttattggagaagatgtgaatcctttagtcaag
ctggatgatgctgtaaatgttgatgagataatgactgatacttctaccagctatcttctg
tgtatctgtgaaaataaggagaatcttaaggaaaaaaaaaaggggagcattttcattgga
atcgtgggagtgcagcctgccacaggtgaggttgtttttgatagtttccaggactctgct
tcccgttcagaactagaaactcggatattgagcttgcagccggtggagctgctgcttcca
tcacacttgtcagagcaaacagagatgctcatccatagagccacagctgttagcgtacgg
gatgacagaattcgagtagaaaggatggataatatgtattttgaatacagccatgctttc
cagatggttacagagttttattcaaatgatgtagttgacatcaaaggttctcaaagtttt
tctggcattattaacttggagaagcctgtgatttgctctttggctgccataataagatac
ctcaaagaatttaacttggaaaaggtgctttccaaacccaagaattttaaacagttgtca
ggtgacatggaatttatgacaattaatggaacaacattaaggaatcttgaaattctacag
aatcagactgataagaaaaccaaaggaagtttattttgggttttagaccatactaaaact
tcatttgggagacggaagttaaagaagtgggtgacccagccactccttaaattaaggaaa
ataaatgatcggcttgacgcagtatctgaagttctccattcagaatccagtgtgtttgat
cagatagaaaatcatctacgtaaattgcctgacatagagagaggactctgtagcatttat
cacaaaaaatgttctacacaagagttctttttgattgtcaaagccctttatcacctgaag
tcagaatttcaagcattaatacctgctgttaattcccacgttcagtcagatttgctccag
acatttattttagaaattcctgaacttctcagtccagtggaacattacttaaagatactt
aatgaacaagctgccaaaattggagataaaactgaattattcaaagacctttctgacttc
cctttgataaaaaggagaaaggatgaaattcaagaggttactgacaagatccaaatacat
ttgcaagaaatacgaaaaatactaaaaaatccttctgcacaatatgtgacagtatcagga
caggagtttatgattgaaataaagaactctgccgtatcttgtataccagctgattggatt
aaggttggaagcacaaaagctgtgagccgctttcactctccttttgttgtagaaaattac
agacatctgaatcagctccgggagcagctagtccttgactgcaatgctgaatggcttgat
tttctagagaatttcagtgaacattatcattccttgtgtaaagcagtacatcacctagca
actattgactgcattttctccctggccaaggtcgctaagcaaggagattactgcaggcca
actttacaagaagaaaggaaaatcatgataaaaaatggccggcatcctgtgattgatgtg
ttgctgggagaacaggatcagtatgttcccaatagtacaaatttatcaggggactcagag
agagtaatgataattactggaccaaacatgggcggaaagagctcctacataaaacaagtt
gcattgattactatcatggctcagattggctcctatgttcctgcagaggaagcaacaatt
ggaattgtgaatggcattttcacgaggatgggtgctgcagataatatatataaaggacac
agtacatttatggaagaactgactgacaccgcagaaataataagaaaagcaacatcacgg
tccttggttatcatggatgaattaggaagagggacaagcacccacgatggaatcgccatt
gcttacgctacacttgagcattttattagagatgtgaagtccttaaccctgtttgtcacc
cattatccgccagtttgtgaattagagaaaagttactcacaacaggtggggaattatcac
atgggattcttggtcaatgagaatgaaagcaaacaagatccaggtgaagaggaagtccct
gaatttgtcacttttctttatcaaataaccagaggaattgcagcaaggagttatggactg
aatgtggctaaactagcagatgttcctgaagaaattttgaagaaagcagctagcaagtca
aaagaactggaaggattagtaaatatgaaaaggaaaaggctgaagtgttttgcaaagtta
tggacgataaatgatgcaaaagacctacaaaagtggacagaccagtttgaagtggaagaa
actacggacttctcttactga

KEGG   Pteropus alecto (black flying fox): 102892999
Entry
102892999         CDS       T02993                                 

Gene name
MSH6
Definition
(RefSeq) DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale03430  Mismatch repair
pale05200  Pathways in cancer
pale05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102892999 (MSH6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102892999 (MSH6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102892999 (MSH6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102892999 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102892999 (MSH6)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     102892999 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II
Other DBs
NCBI-GeneID: 102892999
NCBI-ProteinID: XP_006909673
LinkDB
Position
Unknown
AA seq 1360 aa
MSRQSTLYSFFPKSPALNKANKAPVRASGEGGATAATGASPSPGGDAAWSEAGPGPGPLE
SSASPPEARNLNGGLRRSAAPSVPSSSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI
REKGKCARVHVQFFDDSPTRGWVSRRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRAD
EALNKDKIKRLELAVCDEPSEPEEEEMEVGATYASDKSEEDNEIESEDEVRPKVQGSRRS
SRQIKKRRVISDSESDIGGSDVEFKPDAKEEGSSDEISSGMGDSDSEGLQSSVKVAPKRK
RMVTGNGSLKKKSSRKEMPPATKRSSGISSETKSTLSAFSAPQNSESQAHVSGGCDDSSR
PTVWYHETLEWLKDGKRRDMHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQNF
DLVIFYKVGKFYELYHMDALVGVNELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVA
RVEQTETPEMMEARCRKMAHISKHDKVVRREICRVITKGTQTYSVLEGDPSENYSKYLLS
LKEKEEDTSGHTRVYGVCFVDASLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGNL
STETKMILKGSLSSSLQEGLIPGSQFWDAAKTLRTLLEEGYFTEKLNEGNGVMLPQVLKS
MTSESDSLGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDMVSAIR
PGAVFAKVNQRMVLDSVTLNNLEIFLNGTNGTTEGTLLEKIDTCHTPFGKRLLKQWLCAP
LCNPYAINDRLDAIEDLMVVPDKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDSR
AIMYEETTYSKKKIIDFLSALEGFKVICKIIEIMEEVVDDFKSKILKQIVTMQTKNPEGH
FPDLTIELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRSR
IGCRSIVYWGIGRNRYQLEIPENFITHNLPEEYELKSTKKGCKRYWTKTIEKKLANLINA
EERRDVSLKDCMRRLFYNFDKNYKDWQAAVECITVLDVLLCLANYSRGGDGPMCRPVILL
PKEDTPVFLDLKGSRHPCISKTFFGDDFIPNDILIGCEEEEEENGRAYCVLVTGPNMGGK
STLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASI
LTHATAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQNV
AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARVANLPEEVIQKGHRKA
REFEKMTHSLRLFREVCLASERSTVDAETVHKLLASIEEL
NT seq 4083 nt   +upstreamnt  +downstreamnt
atgtcgcgacagagcacgctgtatagcttcttccccaagtctccagcgctgaataaagcc
aacaaggccccggtcagggcctcaggtgaaggcggcgccactgctgccactggggcctcc
ccttcccccggcggggatgcagcctggagcgaggccgggcctgggcccggtcccttggag
agctccgcgtcgcctcccgaggcgaggaacctcaacggagggctgcggaggtcggcagcg
ccttcggttccctccagttcttgtgacttctcaccaggtgatttggtttgggccaagatg
gagggttacccctggtggccttgcctggtttacaaccacccttttgatggaacattcatc
cgtgagaaagggaagtgtgcccgagttcatgtacagttttttgatgacagcccaacaagg
ggctgggttagcagaaggctcttaaagccatatacaggttcaaaatcaaaggaagcccag
aaaggaggtcatttttacagtgcaaagcctgaaatactcagagcaatgcaacgtgcagat
gaagccttgaataaagacaagattaagaggcttgaattggcagtctgtgatgaaccctca
gaaccagaggaggaagaaatggaggtaggtgcaacttatgcatcagataagagtgaagaa
gataatgaaattgagagtgaagatgaagtgcggcctaaagtgcaaggatctaggcgaagt
agccgccagattaaaaaacggagagtcatatcagactctgagagtgacattggtggctct
gatgtggaatttaagccagatgctaaggaggaaggaagcagtgatgaaataagcagtgga
atgggggacagtgacagtgaaggcctgcagagctctgtcaaagttgctccaaagaggaag
agaatggtgactggaaatggctctctcaaaaagaaaagttcaaggaaagaaatgccccca
gccaccaaacgatcaagtggcatttcatcagaaaccaagagtactttgagtgctttctct
gcccctcagaattctgaatcccaggcccacgttagtggaggatgtgatgatagtagtcgc
cccactgtctggtatcatgaaactttagaatggcttaaggacggaaaaagaagagatatg
cataggaggcgacccgatcatcctgattttgatgcatctacactgtatgtgcctgaggat
ttccttaattcctgtactcctgggatgaggaagtggtggcagattaagtctcagaacttt
gatcttgtcatattttataaggtggggaagttttatgagctgtaccacatggatgctctt
gttggggtcaacgaactagggcttgtattcatgaaaggcaactgggcccattctggtttc
cctgaaattgcttttggccgatattcggattctctggtccagaagggctataaagtagca
cgagtggaacagactgagaccccagaaatgatggaggcacgatgccgaaagatggcacat
atatctaaacatgataaagtggtgaggagggagatttgtagggtcattaccaagggtaca
cagacatacagtgtgctggaaggtgacccctctgagaactacagtaagtatcttcttagc
ctcaaagaaaaagaggaagatacttctggccacactcgtgtatatggtgtatgctttgtt
gatgcctcactgggaaagtttttcataggtcagttttcagatgatcgccattgttcaagg
tttaggactctagtggcacattatcctccggtacaagtgctgtttgagaagggaaatctc
tcaacagaaacaaagatgattttgaagggttcattatcttcttctcttcaggaaggtctt
atcccaggctcccagttttgggatgcagcgaagactttgagaactctccttgaagaagga
tattttacggaaaagttaaatgagggcaatggggtgatgttaccccaagtgcttaaaagt
atgacttcagagtctgattctctaggattgacaccaggagagaaaagtgaattggccctc
tctgcgctaggtggttgtgtcttctacctcaaaaaatgccttattgatcaggagctttta
tcaatggctaattttgaagaatatattcccttggattctgacatggtcagtgctataaga
cctggtgctgtctttgctaaagtcaatcaacgaatggtgctagattctgtgacattaaac
aacttggagatttttttgaatggaacaaatggtactaccgaaggtaccttactagaaaag
attgatacttgccatactccttttggtaagcggctcctaaagcaatggctttgtgcccca
ttgtgtaatccttatgctatcaatgatcgtctagatgctatagaagacctgatggttgtg
cctgacaaaatctctgaggttgtagaccttttaaagaagcttccagaccttgagaggcta
ctgagtaaaattcataatgttgggtctcctctgaaaagccagaaccacccagatagcagg
gctataatgtatgaagaaactacatacagcaaaaaaaagattattgattttctttctgct
ctggaaggattcaaagtaatatgtaaaattatagagattatggaagaagttgtcgatgac
tttaagtctaaaatccttaagcagatcgttactatgcagacgaaaaatcctgaaggccat
tttcctgatttgactatagaactaaaccgatgggatacagcctttgaccatgagaaggct
cgaaagactggactgattactcccaaagcaggatttgactctgattatgaccaagctctt
gctgacataagagaaaacgaacagagcctcctggaatacttggagaaacagcgcagtaga
attggctgtaggagcattgtctactgggggattggtaggaatcgttaccagttggaaatt
ccagaaaatttcatcacccataatttgccagaagaatatgagttgaaatctaccaaaaaa
ggctgtaaacgatattggaccaaaactattgagaagaagttggctaatctgataaatgct
gaagaacggagagacgtatcattgaaggactgcatgcggcgactattctataactttgat
aaaaattacaaggactggcaggctgccgtagagtgcatcacagtgttggatgtcttattg
tgcctggctaactacagtcgagggggtgatggtcctatgtgtcgtccagtaattcttttg
ccaaaagaagacactcctgtcttcttagaccttaaaggatcacgccatccctgcatttca
aagaccttttttggagatgactttattcctaatgacattctaataggctgtgaggaagag
gaggaggaaaatggcagagcttattgtgtgcttgttactggaccaaatatggggggcaag
tctacactcatgagacaggctggtctattagctgtcatggcccagatgggttgttatgta
cctgctgaagtatgtaggctcacaccaattgatagagtgtttactagacttggtgcctca
gacagaataatgtcaggtgaaagtacattttttgttgaattgagtgaaactgccagtata
cttacgcatgcaacagcacattctctggtgcttgtggatgaattaggaagaggtactgca
acatttgatgggacagcaattgcaaatgcagttgttaaagaacttgctgagaatataaag
tgtcgtacattgttttctacccactatcattcattagttgaagattattctcaaaatgtt
gcagtgcgcctaggacacatggcatgcatggtagaaaatgaatgtgaagatcccagccag
gagactattaccttcctttataagtttatcaagggagcttgtcctaaaagctatggcttt
aatgcagcaagggttgctaatcttccagaggaggttattcaaaagggacacagaaaagca
agagaatttgagaagatgactcattcactgcgattatttcgggaagtttgtctggctagt
gaaaggtcgactgtagatgcagaaactgtccataagttgctggcttcgattgaggaatta
tag

DBGET integrated database retrieval system