KEGG   Pteropus alecto (black flying fox): 102879159
Entry
102879159         CDS       T02993                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04932  Non-alcoholic fatty liver disease
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05134  Legionellosis
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05222  Small cell lung cancer
pale05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102879159
   04215 Apoptosis - multiple species
    102879159
   04115 p53 signaling pathway
    102879159
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102879159
  09162 Cancer: specific types
   05210 Colorectal cancer
    102879159
   05222 Small cell lung cancer
    102879159
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102879159
   05012 Parkinson disease
    102879159
   05014 Amyotrophic lateral sclerosis
    102879159
   05016 Huntington disease
    102879159
   05017 Spinocerebellar ataxia
    102879159
   05020 Prion disease
    102879159
   05022 Pathways of neurodegeneration - multiple diseases
    102879159
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102879159
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102879159
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102879159
   05134 Legionellosis
    102879159
   05152 Tuberculosis
    102879159
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102879159
   05161 Hepatitis B
    102879159
   05160 Hepatitis C
    102879159
   05164 Influenza A
    102879159
   05162 Measles
    102879159
   05168 Herpes simplex virus 1 infection
    102879159
   05163 Human cytomegalovirus infection
    102879159
   05167 Kaposi sarcoma-associated herpesvirus infection
    102879159
   05169 Epstein-Barr virus infection
    102879159
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102879159
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102879159
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 102879159
NCBI-ProteinID: XP_006912065
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKSGERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaaaggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag
acaggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgctggcattaagaagtctggagaaagggcagacttgatagcttatctcaaa
aaagctaccaaggagtaa

KEGG   Pteropus alecto (black flying fox): 102893036
Entry
102893036         CDS       T02993                                 

Definition
(RefSeq) cytochrome c, testis-specific-like
  KO
K08738  cytochrome c
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04932  Non-alcoholic fatty liver disease
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05017  Spinocerebellar ataxia
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05134  Legionellosis
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05222  Small cell lung cancer
pale05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102893036
   04215 Apoptosis - multiple species
    102893036
   04115 p53 signaling pathway
    102893036
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893036
  09162 Cancer: specific types
   05210 Colorectal cancer
    102893036
   05222 Small cell lung cancer
    102893036
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102893036
   05012 Parkinson disease
    102893036
   05014 Amyotrophic lateral sclerosis
    102893036
   05016 Huntington disease
    102893036
   05017 Spinocerebellar ataxia
    102893036
   05020 Prion disease
    102893036
   05022 Pathways of neurodegeneration - multiple diseases
    102893036
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102893036
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102893036
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102893036
   05134 Legionellosis
    102893036
   05152 Tuberculosis
    102893036
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102893036
   05161 Hepatitis B
    102893036
   05160 Hepatitis C
    102893036
   05164 Influenza A
    102893036
   05162 Measles
    102893036
   05168 Herpes simplex virus 1 infection
    102893036
   05163 Human cytomegalovirus infection
    102893036
   05167 Kaposi sarcoma-associated herpesvirus infection
    102893036
   05169 Epstein-Barr virus infection
    102893036
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102893036
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102893036
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Dehyd-heme_bind
Other DBs
NCBI-GeneID: 102893036
NCBI-ProteinID: XP_006921298
LinkDB
Position
Unknown
AA seq 105 aa
MGDAETGKKILTQKCAQCHTVEKDGKHKTGPNLWDLFGRKTGQAPGFSYLDANKNKGVIW
GEETLMEYLGNPTNYILGTKIIFAGLKKENEREDLIQYLKRATSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatgctgagacgggcaagaagatccttactcaaaaatgtgctcagtgccacaca
gtggaaaaagatggaaaacacaagactggtccaaatctctgggacctttttggccgaaaa
acaggacaagcaccaggattttcttatttggatgcaaacaaaaataaaggtgttatctgg
ggagaggaaactctgatggaatatttggggaacccaacaaattatatcctaggaactaaa
attatatttgctggtcttaaaaaggagaatgagagagaagatcttattcagtatttgaaa
cgggcaacatcttcatga

DBGET integrated database retrieval system